Independent Antibodies: Western Blot: WDR61 Antibody [NBP1-80845] - Analysis using Anti-WDR61 antibody NBP1-80845 (A) shows similar pattern to independent antibody NBP1-80844 (B).
Immunocytochemistry/ Immunofluorescence: WDR61 Antibody [NBP1-80845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human colon.
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.
Independent Antibodies: Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human cerebral cortex, colon, kidney and testis using Anti-WDR61 antibody NBP1-80845 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human testis.
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human kidney.
Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human cerebral cortex.
Novus Biologicals Rabbit WDR61 Antibody - BSA Free (NBP1-80845) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-WDR61 Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVD
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SKIC8
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for WDR61 Antibody - BSA Free
Meiotic recombination REC14 protein homolog
REC14
recombination protein REC14
SKI8
WD repeat domain 61
WD repeat-containing protein 61
Background
WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our WDR61 Antibody - BSA Free and receive a gift card or discount.