WDR61 Antibody - BSA Free

Western Blot: WDR61 Antibody [NBP1-80845] - Analysis using Anti-WDR61 antibody NBP1-80845 (A) shows similar pattern to independent antibody NBP1-80844 (B).

Immunocytochemistry/Immunofluorescence: WDR61 Antibody [NBP1-80845] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human colon.

Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human testis shows strong cytoplasmic and nuclear positivity in cells in seminiferus ducts.

Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human cerebral cortex, colon, kidney and testis using Anti-WDR61 antibody NBP1-80845 (A) shows similar protein distribution across tissues to independent antibody NBP1-80844 (B).

Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human testis.

Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human kidney.

Immunohistochemistry-Paraffin: WDR61 Antibody [NBP1-80845] - Staining of human cerebral cortex.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

WDR61 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TNQYGILFKQEQAHDDAIWSVAWGTNKKENSETVVTGSLDDLVKVWKWRDERLDLQWSLEGHQLGVVSVD
• Predicted Species: Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SKIC8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  WDR61 Protein (NBP1-80845PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WDR61 Antibody - BSA Free

• Meiotic recombination REC14 protein homolog
• REC14
• recombination protein REC14
• SKI8
• WD repeat domain 61
• WD repeat-containing protein 61

Background

WDR61 is a subunit of the human PAF and SKI complexes, which function in transcriptional regulation and are involved in events downstream of RNA synthesis, such as RNA surveillance (Zhu et al., 2005 [PubMed 16024656]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR61 Antibody (NBP1-80845)(2)

Publications using NBP1-80845

• Hubschmann V, Korkut-Demirbas M, Siegert S. Assessing human iPSC-derived microglia identity and function by immunostaining, phagocytosis, calcium activity, and inflammation assay STAR Protocols 2022-12-01 [PMID: 36595902] (ICC/IF, Human)
  
  Details:
  1:100 dilution ICC/IF
• Farkas MH, Skelton LA, Ramachandra-Rao S et al. Morphological, biochemical, and transcriptomic characterization of iPSC-derived human RPE cells from normal and Smith-Lemli-Opitz syndrome patients Molecular Vision 2022-01-01 [PMID: 36540063] (IHC-P, Human)
  
  Details:
  1:100 dilution IHC-P

Bioinformatics

• Gene Symbol: SKIC8
• Entrez:
  • 80349(Human)
• Uniprot:
  • Q9GZS3(Human)