ZA20D3 Antibody

Images

 
Western Blot: ZA20D3 Antibody [NBP1-90060] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more
Immunohistochemistry-Paraffin: ZA20D3 Antibody [NBP1-90060] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZA20D3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZFAND6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZA20D3 Protein (NBP1-90060PEP)
Publications
Read Publication using NBP1-90060.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZA20D3 Antibody

  • Associated with PRK1 protein
  • AWP1Zinc finger A20 domain-containing protein 3
  • protein associated with PRK1
  • ZA20D3AN1-type zinc finger protein 6
  • ZFAND5B
  • zinc finger, A20 domain containing 3
  • zinc finger, AN1-type domain 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-56429
Species: Hu
Applications: WB, ICC/IF
NBP1-92058
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-49881
Species: Mu, Rt
Applications: WB, PEP-ELISA
NBP1-80955
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-79438
Species: Hu
Applications: WB
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP1-32743
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZA20D3 Antibody (NBP1-90060)(1)

Reviews for ZA20D3 Antibody (NBP1-90060) (0)

There are no reviews for ZA20D3 Antibody (NBP1-90060). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZA20D3 Antibody (NBP1-90060) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZA20D3 Products

Bioinformatics Tool for ZA20D3 Antibody (NBP1-90060)

Discover related pathways, diseases and genes to ZA20D3 Antibody (NBP1-90060). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZA20D3 Antibody (NBP1-90060)

Discover more about diseases related to ZA20D3 Antibody (NBP1-90060).
 

Pathways for ZA20D3 Antibody (NBP1-90060)

View related products by pathway.

PTMs for ZA20D3 Antibody (NBP1-90060)

Learn more about PTMs related to ZA20D3 Antibody (NBP1-90060).

Blogs on ZA20D3

There are no specific blogs for ZA20D3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZA20D3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZFAND6