ZA20D3 Antibody - BSA Free

Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.

Staining of human skeletal muscle shows weak cytoplasmic positivity in myocytes.

Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissue

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ZA20D3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ZA20D3 Antibody - BSA Free (NBP1-90060) is a polyclonal antibody validated for use in IHC and WB. Anti-ZA20D3 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK
• Predicted Species: Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZFAND6
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ZA20D3 Protein (NBP1-90060PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ZA20D3 Antibody - BSA Free

• Associated with PRK1 protein
• AWP1Zinc finger A20 domain-containing protein 3
• protein associated with PRK1
• ZA20D3AN1-type zinc finger protein 6
• ZFAND5B
• zinc finger, A20 domain containing 3
• zinc finger, AN1-type domain 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZA20D3 Antibody (NBP1-90060)(1)

Publication using NBP1-90060

• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: ZFAND6