KHSRP Antibody (4V4O1)

Western Blot: KHSRP Antibody (4V4O1) [NBP3-16746] - Western blot analysis of extracts of various cell lines, using KHSRP Rabbit mAb (NBP3-16746) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunoprecipitation: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunoprecipitation analysis of 300ug extracts of HepG2 cells using 3ug KHSRP antibody (NBP3-16746). Western blot was performed from the immunoprecipitate using KHSRP antibody (NBP3-16746) at a dilition of 1:1000.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded rat liver tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse liver tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse colon tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human thyroid tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast cancer tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded rat colon tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human esophagus tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse spleen tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded human breast tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: KHSRP Antibody (4V4O1) [NBP3-16746] - Immunohistochemistry analysis of KHSRP in paraffin-embedded mouse heart tissue using KHSRP Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clone: 4V4O1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

KHSRP Antibody (4V4O1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human KHSRP (Q92945). MSDYSTGGPPPGPPPPAGGGGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGSAGGPSQPPGGGGPGIRKDAFADAVQRARQIAAKIGGDAATTVNNSTPDFGFGGQKRQLEDGDQPESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCKVQI
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: KHSRP
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KHSRP Antibody (4V4O1)

• FBP2far upstream element-binding protein 2
• FUBP2p75
• FUSE binding protein 2
• FUSE-binding protein 2
• KH type-splicing regulatory protein
• KH-type splicing regulatory protein
• KSRPMGC99676

Background

KH-type splicing regulatory protein (KSRP) contains four K homology RNA-binding domains. KH domains are found in a wide variety of proteins including ribosomal proteins, transcription factors, and mRNA processing proteins. KSRP has been found to promote the degradation of mRNAs that encode proteins involved in proliferation and the inflammatory response. Alternative names for KSRP include Far upstream element-binding protein 2, FUSE-binding protein 2, p75 and FUBP2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KHSRP