KHDRBS3 Antibody

Images

 
Orthogonal Strategies: Western Blot: KHDRBS3 Antibody [NBP2-55220] - Analysis in human cell line U-2 OS and human cell line A-431.
Immunocytochemistry/ Immunofluorescence: KHDRBS3 Antibody [NBP2-55220] - Staining of human cell line U-251 MG shows localization to nucleoplasm. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

KHDRBS3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ADVPVVRGKPTLRTRGVPAPAITRGRGGVTARPVGVVVPRGTPTPRGVLSTRGPVSRGRGLLTPRARGVPPTGYRPPPPPPTQETYGEYDYDDGYGTAYDEQSYDS
Specificity
Specificity of human KHDRBS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KHDRBS3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for KHDRBS3 Antibody

  • Etle
  • etoile
  • KH domain containing, RNA binding, signal transduction associated 3
  • SALPRNA-binding protein T-Star
  • Sam68-like mammalian protein 2
  • Sam68-like phosphotyrosine protein
  • Sam68-like phosphotyrosine protein, T-STAR
  • SLM-2KH domain-containing, RNA-binding, signal transduction-associated protein 3
  • SLM2TSTAR
  • T-STAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19151
Species: Hu, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37254
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
H00002984-M09
Species: Hu
Applications: WB, ELISA, S-ELISA
NBP2-14001
Species: Hu
Applications: IHC, IHC-P
NBP1-33485
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20029
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32887
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81353
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-61574
Species: Hu, Mu, Bv, Gt, Sh
Applications: WB
AF2685
Species: Hu
Applications: WB, Simple Western, IHC

Publications for KHDRBS3 Antibody (NBP2-55220) (0)

There are no publications for KHDRBS3 Antibody (NBP2-55220).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KHDRBS3 Antibody (NBP2-55220) (0)

There are no reviews for KHDRBS3 Antibody (NBP2-55220). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KHDRBS3 Antibody (NBP2-55220) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional KHDRBS3 Products

Bioinformatics Tool for KHDRBS3 Antibody (NBP2-55220)

Discover related pathways, diseases and genes to KHDRBS3 Antibody (NBP2-55220). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KHDRBS3 Antibody (NBP2-55220)

Discover more about diseases related to KHDRBS3 Antibody (NBP2-55220).
 

Pathways for KHDRBS3 Antibody (NBP2-55220)

View related products by pathway.

PTMs for KHDRBS3 Antibody (NBP2-55220)

Learn more about PTMs related to KHDRBS3 Antibody (NBP2-55220).

Blogs on KHDRBS3

There are no specific blogs for KHDRBS3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KHDRBS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KHDRBS3