Ketohexokinase Antibody - BSA Free

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining in human small intestine and skeletal muscle tissues . Corresponding KHK RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Analysis in human cell line HepG2.

Analysis in mouse liver tissue and rat liver tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ketohexokinase Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Ketohexokinase Antibody - BSA Free (NBP1-85790) is a polyclonal antibody validated for use in IHC and WB. Anti-Ketohexokinase Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KHK
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Ketohexokinase Protein (NBP1-85790PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22371574)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ketohexokinase Antibody - BSA Free

• EC 2.7.1.3
• Fructokinase
• Hepatic fructokinase
• ketohexokinase (fructokinase)
• Ketohexokinase
• KHK

Background

ketohexokinase encodes ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose. Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ketohexokinase Antibody (NBP1-85790)(3)

Publications using NBP1-85790

• Mirtschink P, Krishnan J, Grimm F et al. HIF-driven SF3B1 induces KHK-C to enforce fructolysis and heart disease. Nature 2015-06-25 [PMID: 26083752] (WB, Mouse)
• Lanaspa MA, Ishimoto T, Li N et al. Endogenous fructose production and metabolism in the liver contributes to the development of metabolic syndrome. Nat Commun 2013-01-01 [PMID: 24022321]
• Ishimoto T, Lanaspa MA, Le MT et al. Opposing effects of fructokinase C and A isoforms on fructose-induced metabolic syndrome in mice. Proc Natl Acad Sci U S A 2012-03-13 [PMID: 22371574]

Bioinformatics

• Gene Symbol: KHK