Ketohexokinase Antibody

Images

 
Western Blot: Ketohexokinase Antibody [NBP1-85790] - Western blot analysis in mouse liver tissue and rat liver tissue.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining in human small intestine and skeletal muscle tissues. Corresponding KHK RNA-seq data are presented for the ...read more
Western Blot: Ketohexokinase Antibody [NBP1-85790] - Analysis in human cell line HepG2.
Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Ketohexokinase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQV
Specificity
Specificity of human Ketohexokinase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KHK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ketohexokinase Protein (NBP1-85790PEP)
Publications
Read Publications using
NBP1-85790 in the following applications:

  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22371574)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ketohexokinase Antibody

  • EC 2.7.1.3
  • Fructokinase
  • Hepatic fructokinase
  • ketohexokinase (fructokinase)
  • Ketohexokinase
  • KHK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47980
Species: Hu, Pm
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-47778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IP
NBP1-84127
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-75717
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32317
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67560
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03621
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
NBP2-75418
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-90233
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-92824
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-70092
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-75398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-62658
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for Ketohexokinase Antibody (NBP1-85790)(3)

Reviews for Ketohexokinase Antibody (NBP1-85790) (0)

There are no reviews for Ketohexokinase Antibody (NBP1-85790). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ketohexokinase Antibody (NBP1-85790) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ketohexokinase Products

Bioinformatics Tool for Ketohexokinase Antibody (NBP1-85790)

Discover related pathways, diseases and genes to Ketohexokinase Antibody (NBP1-85790). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ketohexokinase Antibody (NBP1-85790)

Discover more about diseases related to Ketohexokinase Antibody (NBP1-85790).
 

Pathways for Ketohexokinase Antibody (NBP1-85790)

View related products by pathway.

PTMs for Ketohexokinase Antibody (NBP1-85790)

Learn more about PTMs related to Ketohexokinase Antibody (NBP1-85790).
 

Research Areas for Ketohexokinase Antibody (NBP1-85790)

Find related products by research area.

Blogs on Ketohexokinase

There are no specific blogs for Ketohexokinase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ketohexokinase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KHK