Ketohexokinase Antibody

Western Blot: Ketohexokinase Antibody [NBP1-85790] - Western blot analysis in mouse liver tissue and rat liver tissue.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining in human small intestine and skeletal muscle tissues. Corresponding KHK RNA-seq data are presented for the same tissues.

Western Blot: Ketohexokinase Antibody [NBP1-85790] - Analysis in human cell line HepG2.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: Ketohexokinase Antibody [NBP1-85790] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

Ketohexokinase Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQV
• Specificity: Specificity of human Ketohexokinase antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KHK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22371574)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Ketohexokinase Antibody

• EC 2.7.1.3
• Fructokinase
• Hepatic fructokinase
• ketohexokinase (fructokinase)
• Ketohexokinase
• KHK

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Ketohexokinase Antibody (NBP1-85790)(3)

Publications using NBP1-85790

• Peter Mirtschink, Jaya Krishnan, Fiona Grimm et al. HIF-driven SF3B1 induces KHK-C to enforce fructolysis and heart disease. Nature 2015 [PMID: 26083752] (WB, Mouse)
• Lanaspa MA, Ishimoto T, Li N et al. Endogenous fructose production and metabolism in the liver contributes to the development of metabolic syndrome. Nat Commun 2013 [PMID: 24022321]
• Ishimoto T, Lanaspa MA, Le MT et al. Opposing effects of fructokinase C and A isoforms on fructose-induced metabolic syndrome in mice. Proc Natl Acad Sci U S A 2012 Mar 13 [PMID: 22371574]

Bioinformatics

• Gene Symbol: KHK