GLYCTK Antibody - BSA Free Summary
Description |
Novus Biologicals Rabbit GLYCTK Antibody - BSA Free (NBP1-83292) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVG |
Predicted Species |
Rat (94%). Backed by our 100% Guarantee. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
GLYCTK |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Paraffin 1:20-1:50
- Western Blot 1:100-1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for GLYCTK Antibody - BSA Free
Background
GLYCTK, also known as Glycerate kinase, has 7 isoforms, a 523 amino acid isoform 1 that is 55 kDa, a 234 amino acid isoform 2 that is 25 k Da, a 457 amino acid isoform 3 that is 48 kDa, a 367 amino acid isoform 4 that is 39 kDa, a 240 amino acid isoform 5 that is 25 kDa, a 205 amino acid isoform 6 that is 22 kDa, and a 187 amino acid isoform 7 that is 20 kDa; acts as a catalyzer of the phosphorylation of (R)-glycerate and may be involved in serine degradation and fructose metabolism. This protein is being studied for its involvement in microcephaly and seizures. GLYCTK has been linked to glycine, serine and threonine metabolism, glycerolipid metabolism, and glyoxylate and dicarboxylate metabolism pathways where interacts with TRIP13, ALDH1B1, ALDH2, ALDH7A1, and GRHPR proteins.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IP, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ec, Mu
Applications: CyTOF-ready, Flow-IC, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Bv, ChHa, Dr, Fu, Hu, Mu, Pl, Pr, Rb, Rt, Sh, Xp, Ye, Ze
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Fe, Hu
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu
Applications: IHC, IHC-P, WB
Publications for GLYCTK Antibody (NBP1-83292) (0)
There are no publications for GLYCTK Antibody (NBP1-83292).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for GLYCTK Antibody (NBP1-83292) (0)
There are no reviews for GLYCTK Antibody (NBP1-83292).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for GLYCTK Antibody (NBP1-83292) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional GLYCTK Products
Research Areas for GLYCTK Antibody (NBP1-83292)
Find related products by research area.
|
Blogs on GLYCTK