GLYCTK Antibody

Images

 
Western Blot: GLYCTK Antibody [NBP1-83292] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: GLYCTK Antibody [NBP1-83292] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: GLYCTK Antibody [NBP1-83292] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLYCTK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IRAAMERAGKQEMLLKPHSRVQVFEGAEDNLPDRDALRAALAIQQLAEGLTADDLLLVLISGGGSALLPAPIPPVTLEEKQTLTRLLAARGATIQELNTIRKALSQLKGGGLAQAAYPAQVVSLILSDVVG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLYCTK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
GLYCTK Protein (NBP1-83292PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLYCTK Antibody

  • EC 2.7.1.31
  • glycerate kinase
  • GLYCTK1
  • HBeAg-binding protein 2
  • HBeAg-binding protein 4
  • HBeAgBP4A
  • HBEBP2
  • HBEBP4HBeAg binding protein 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-57033
Species: Hu
Applications: WB
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02639
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1970
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-54755
Species: Hu
Applications: WB
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-54825
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31241
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-53164
Species: Hu
Applications: WB
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34980
Species: Hu
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
NBP2-14080
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GLYCTK Antibody (NBP1-83292) (0)

There are no publications for GLYCTK Antibody (NBP1-83292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLYCTK Antibody (NBP1-83292) (0)

There are no reviews for GLYCTK Antibody (NBP1-83292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLYCTK Antibody (NBP1-83292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLYCTK Products

Bioinformatics Tool for GLYCTK Antibody (NBP1-83292)

Discover related pathways, diseases and genes to GLYCTK Antibody (NBP1-83292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLYCTK Antibody (NBP1-83292)

Discover more about diseases related to GLYCTK Antibody (NBP1-83292).

Blogs on GLYCTK

There are no specific blogs for GLYCTK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLYCTK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLYCTK