KCNK1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: KCNK1 Antibody [NBP1-84987] - Immunofluorescent staining of human cell line HeLa shows localization to vesicles.

Immunohistochemistry-Paraffin: KCNK1 Antibody [NBP1-84987] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNK1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNK1 Antibody - BSA Free (NBP1-84987) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KCNK1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCNK1 Protein (NBP1-84987PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Reactivity reported in scientific literature (PMID: 21964404)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCNK1 Antibody - BSA Free

• DPK
• HOHO1
• Inward rectifying potassium channel protein TWIK-1
• K2P1
• K2p1.1
• KCNK1
• KCNO1
• Potassium channel KCNO1
• potassium channel subfamily K member 1
• potassium channel, subfamily K, member 1
• potassium inwardly-rectifying channel, subfamily K, member 1
• TWIK1
• TWIK-1
• TWIK1HOHO

Background

K+ channels are divided into three subclasses, reflecting the number of transmembrane segments (TMS), which are designated 6TMS, 4TMS and 2TMS. Members of the 4TMS class contain two distinct pore regions, and include TASK, TREK, TRAAK and TWIK. TWIK-1 mRNA is expressed abundantly in brain and at lower levels in lung, kidney and skeletal muscle. The molecular weight of TWIK-1 in mouse brain is 40 kDa under reducing conditions. TWIK-2 shares low sequence homology with other mammalian family group members, and only 34% homology with TWIK-1. Human TWIK-2 is expressed in pancreas, placenta and heart, while mouse TWIK-2 is expressed in liver. TWIK-2 is inhibited by intracellular, but not extracellular, acidification.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCNK1 Antibody (NBP1-84987)(1)

Publication using NBP1-84987

• Zhao KQ, Xiong G, Wilber M et al. A role for two-pore K+ channels in modulating Na+ absorption and Cl- secretion in normal human bronchial epithelial cells. Am J Physiol Lung Cell Mol Physiol 2012-01-01 [PMID: 21964404]

Bioinformatics

• Gene Symbol: KCNK1