KCNK1 Antibody

Images

 
Western Blot: KCNK1 Antibody [NBP1-84987] - Analysis in control (vector only transfected HEK293T lysate) and kCNK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: KCNK1 Antibody [NBP1-84987] - Immunofluorescent staining of human cell line HeLa shows localization to vesicles.
Immunohistochemistry-Paraffin: KCNK1 Antibody [NBP1-84987] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KCNK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN
Specificity
Specificity of human KCNK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCNK1 Protein (NBP1-84987PEP)
Publications
Read Publication using NBP1-84987.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%). Reactivity reported in scientific literature (PMID: 21964404)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNK1 Antibody

  • DPK
  • HOHO1
  • Inward rectifying potassium channel protein TWIK-1
  • K2P1
  • K2p1.1
  • KCNO1
  • Potassium channel KCNO1
  • potassium channel subfamily K member 1
  • potassium channel, subfamily K, member 1
  • potassium inwardly-rectifying channel, subfamily K, member 1
  • TWIK-1
  • TWIK1HOHO

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42202
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-41535
Species: Hu, Mu, Bv
Applications: ICC/IF (-), IHC (-), WB
NBP2-34063
Species: Hu
Applications: IHC, IHC-P
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-04360
Species: Hu
NBP1-69621
Species: Hu
Applications: WB
NBP1-81571
Species: Hu
Applications: IHC, IHC-P
NBP1-80271
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-1869
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NBP2-57882
Species: Hu
Applications: ICC/IF
NB110-74682
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-87709
Species: Hu
Applications: IHC, IHC-P

Publications for KCNK1 Antibody (NBP1-84987)(1)

Reviews for KCNK1 Antibody (NBP1-84987) (0)

There are no reviews for KCNK1 Antibody (NBP1-84987). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for KCNK1 Antibody (NBP1-84987) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for KCNK1 Antibody (NBP1-84987)

Discover related pathways, diseases and genes to KCNK1 Antibody (NBP1-84987). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNK1 Antibody (NBP1-84987)

Discover more about diseases related to KCNK1 Antibody (NBP1-84987).
 

Pathways for KCNK1 Antibody (NBP1-84987)

View related products by pathway.

PTMs for KCNK1 Antibody (NBP1-84987)

Learn more about PTMs related to KCNK1 Antibody (NBP1-84987).

Blogs on KCNK1

There are no specific blogs for KCNK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNK1