KCNK1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit KCNK1 Antibody - BSA Free (NBP1-84987) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-KCNK1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNK1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
| Publications |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%). Reactivity reported in scientific literature (PMID: 21964404)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KCNK1 Antibody - BSA Free
Background
K+ channels are divided into three subclasses, reflecting the number of transmembrane segments (TMS), which are designated 6TMS, 4TMS and 2TMS. Members of the 4TMS class contain two distinct pore regions, and include TASK, TREK, TRAAK and TWIK. TWIK-1 mRNA is expressed abundantly in brain and at lower levels in lung, kidney and skeletal muscle. The molecular weight of TWIK-1 in mouse brain is 40 kDa under reducing conditions. TWIK-2 shares low sequence homology with other mammalian family group members, and only 34% homology with TWIK-1. Human TWIK-2 is expressed in pancreas, placenta and heart, while mouse TWIK-2 is expressed in liver. TWIK-2 is inhibited by intracellular, but not extracellular, acidification.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: ELISA, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Publications for KCNK1 Antibody (NBP1-84987)(1)
Showing Publication 1 -
1 of 1.
Reviews for KCNK1 Antibody (NBP1-84987) (0)
There are no reviews for KCNK1 Antibody (NBP1-84987).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for KCNK1 Antibody (NBP1-84987) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCNK1 Products
Research Areas for KCNK1 Antibody (NBP1-84987)
Find related products by research area.
|
Blogs on KCNK1