Home » Kv3.3 » Kv3.3 Antibodies » Kv3.3 Antibody (1C1)

Kv3.3 Antibody (1C1)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Kv3.3 Antibody (1C1) Summary

Immunogen
KCNC3 (NP_004968 671 a.a. - 757 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Specificity
KCNC3 (1C1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00003748-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv3.3 Antibody (1C1)

  • KSHIIID
  • KV3.3
  • potassium voltage-gated channel subfamily C member 3
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • SCA13
  • Shaw-related voltage-gated potassium channel protein 3
  • spinocerebellar ataxia 13
  • voltage-gated potassium channel protein KV3.3
  • Voltage-gated potassium channel subunit Kv3.3

Background

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Potassium Channel
Kv3.1 Antibody
NBP1-42819
Western Blot: Potassium Channel Kv3.1 Antibody [NBP1-42819] - Membrane preparations from HEK-293 cells untransfected (lane 1), transfected with Kv3.1 (lanes 2 and 4) and transfected with Kv1.2 (lane 3) were subjected to SDS-PAGE and were Western blotted with Kv3.1 Antibody (NBP1-42819). Lane 4 was probed with NBP1-42819 that had been preincubated with the peptide used to generate NBP1-42819.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
Kv3.4 Antibody
(S72-16)
NBP1-47609
Western Blot: Kv3.4 Antibody (S72-16) [NBP1-47609] - analysis of Rat brain membrane lysate showing detection of Kv3.4 Potassium Channel protein using Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody, Clone S72-16. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunohistochemistry-Paraffin: Kv3.4 Antibody (S72-16) [NBP1-47609] - Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Hints of filaggrinlike staining.
Immunohistochemistry-Paraffin: Kv3.4 Antibody (S72-16) [NBP1-47609] - Tissue: HaCaT cells. Species: Human. Fixation: Cold 100% methanol for 10 minutes at -20C. Primary Antibody: Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: All cells positive, stains nucleoli.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Kv3.2 Antibody
(S410-17)
NBP2-59328
Western Blot: Kv3.2 Antibody (S410-17) [NBP2-59328] - Analysis of Mouse, Rat Brain showing detection of ~80-100 kDa Kv3.2 protein using Mouse Anti-Kv3.2 Monoclonal Antibody, Clone S410-17. Lane 1: MW Ladder. Lane 2: Mouse Brain. Lane 3: Rat Brain Membrane.Lane 4: Rat Brain. Load: 20 ug. Block: 2% GE Healthcare Blocker for 1 hour at RT. Primary Antibody: Mouse Anti-Kv3.2 Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~80-100 kDa. Other Band(s): ~30 kDa for Rat Brain.
Immunocytochemistry/Immunofluorescence: Kv3.2 Antibody (S410-17) [NBP2-59328] - Analysis using Mouse Anti-Kv3.2 Monoclonal Antibody, Clone S410-17. Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Kv3.2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Cell Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) Kv3.2 Antibody (D) Composite.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Kv1.4 Antibody
NBP1-89691
Immunohistochemistry-Paraffin: Kv1.4 Antibody [NBP1-89691] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
Kv4.2 Antibody
(5B11B9)
NBP2-52497
Western Blot: Kv4.2 Antibody (5B11B9) [NBP2-52497] - Western blot analysis using KCND2 mAb against human KCND2 (AA: 27-184) recombinant protein. (Expected MW is 42.3 kDa)
Flow Cytometry: Kv4.2 Antibody (5B11B9) [NBP2-52497] - Analysis of Hela cells using KCND2 mouse mAb (green) and negative control (red).
Western Blot: Kv4.2 Antibody (5B11B9) [NBP2-52497] - Analysis using KCND2 mAb against HEK293 (1) and KCND2 (AA: 27-184)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Kv4.3 Antibody
NBP1-82864
Immunohistochemistry-Paraffin: Kv4.3 Antibody [NBP1-82864] - Staining of human cerebellum shows cytoplasmic positivity in cells in granular layer.
Species: Hu
Applications: IHC, IHC-P
KCNB1 Antibody
NBP2-38498
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining in human cerebral cortex and pancreas tissues using anti-KCNB1 antibody. Corresponding KCNB1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
GAD1/GAD67
Antibody [Unconjugate
AF2086
Western blot shows lysates of human brain (hypothalamus) tissue, mouse brain (total) tissue, and rat brain (total) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat GAD1/GAD67 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2086) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for GAD1/GAD67 at approximately 67 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse brain tissue, loaded at 0.2 mg/mL. A specific band was detected for GAD1/GAD67 at approximately 65 kDa (as indicated) using 1 µg/mL of Goat Anti-Human/Mouse/Rat GAD1/GAD67 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2086) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
GAD1/GAD67 was detected in immersion fixed paraffin-embedded sections of human spinal cord using 15 µg/mL Goat Anti-Human/Mouse/Rat GAD1/GAD67 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2086) overnight at 4 °C. Tissue was stained with the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Kv1.5 Antibody
NBP2-33891
Immunohistochemistry: Kv1.5 Antibody [NBP2-33891] - Staining of human colon shows distinct membranous and cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
Kv1.2 Antibody
NBP1-42802
Immunocytochemistry/Immunofluorescence: Kv1.2 Antibody [NBP1-42802] - Detection of Kv1.2 (Green) in 293 human embryonic kidney cells using NBP1-42802. Nuclei (Blue) are counterstained using Hoechst 33258.
(2 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
Kv1.3 Antibody
(1D8)
H00003738-M01
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8. Analysis of KCNA3 expression in Jurkat.
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8 Analysis of KCNA3 expression in Hela S3 NE.
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8. Analysis of KCNA3 expression in human liver.
Species: Hu
Applications: WB, ELISA
KCNK3 Antibody
(S374-48)
NBP2-42202
Western Blot: KCNK3 Antibody (S374-48) [NBP2-42202] - Analysis of Rat Brain Membrane showing detection of ~50 kDa TASK1 Potassium Channel protein using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48. Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat brain membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:2000 for 60 min at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: 50 kDa.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
IP3R1 Antibody
NBP1-21398
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
Immunohistochemistry: IP3R1 Antibody [NBP1-21398] - Sample: FFPE section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated (A120-601D4
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
VGLUT1 Antibody
(2754)
NBP2-46627
Western Blot: VGLUT1 Antibody (2754) [NBP2-46627] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunocytochemistry/Immunofluorescence: VGLUT1 Antibody (2754) [NBP2-46627] - Staining of rat brain shows strong positivity in glutamatergic processes in the molecular and granular layers of cerebellum.
Immunohistochemistry-Paraffin: VGLUT1 Antibody (2754) [NBP2-46627] - Staining in human cerebral cortex and tonsil tissues. Corresponding VGLUT1 RNA-seq data are presented for the same tissues.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PKC gamma Antibody
NBP1-58916
Western Blot: PKC gamma Antibody [NBP1-58916] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Chromatin Immunoprecipitation: PKC gamma Antibody [NBP1-58916] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Western Blot: PKC gamma Antibody [NBP1-58916] - Human Placenta lysate, concentration 0.2-1 ug/ml.
(1 Review)
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
Tau tubulin kinase
2 Antibody
NBP1-92476
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human testis shows moderate cytoplasmic positivity in spermatids and sperm.
(2 Publications)
Species: Hu
Applications: IHC, IHC-P
Spectrin beta 3
Antibody (3B1NB)
NBP2-44310
Immunocytochemistry/Immunofluorescence: Spectrin beta 3 Antibody (3B1NB) [NBP2-44310] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-Spectrin beta 3 (3B1NB) conjugated to Alexa Fluor 488 [NBP2-44310AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody (3B1NB) [NBP2-44310] - IHC analysis of a formalin fixed and paraffin embedded tissue section of normal human prostate using 1:200 dilution of Spectrin beta 3 antibody (clone 3B1NB). The antibody generated a specific cytoplasmic staining with strong signal at cell-cell junctions in the glandular epithelium of the prostate section. The cells of fibromuscular stroma showed a diffused signal throughout the sections.
Flow (Cell Surface): Spectrin beta 3 Antibody (3B1NB) [NBP2-44310] - Analysis using the Azide Free version of NBP2-44310. Detection of HeLa cells (1 x 10^6 cells/ml) at a 1:500 dilution detected using Dylight-488 conjugated goat anti-rat IgG secondary antibody (blue peak). Shown with secondary control (orange peak).
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Flow-CS
FGF14 Antibody
NBP2-55745
Immunocytochemistry/Immunofluorescence: FGF14 Antibody [NBP2-55745] - Staining of human cell line SH-SY5Y shows localization to nucleoli fibrillar center.
Species: Hu
Applications: ICC/IF
Kv4.1 Antibody
NBP1-81336
Western Blot: Kv4.1 Antibody [NBP1-81336] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kv4.1 Antibody [NBP1-81336] - Staining of human cerebellum shows moderate positivity in granular layer.
Species: Hu
Applications: WB, IHC, IHC-P
Kv3.3 Antibody
(1C1)
H00003748-M01
Kv3.3 Antibody (1C1)
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for Kv3.3 Antibody (H00003748-M01)(1)


Reviews for Kv3.3 Antibody (H00003748-M01) (0)

There are no reviews for Kv3.3 Antibody (H00003748-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kv3.3 Antibody (H00003748-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Kv3.3 Antibody (H00003748-M01)

Discover related pathways, diseases and genes to Kv3.3 Antibody (H00003748-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.3 Antibody (H00003748-M01)

Discover more about diseases related to Kv3.3 Antibody (H00003748-M01).
 

Pathways for Kv3.3 Antibody (H00003748-M01)

View related products by pathway.

PTMs for Kv3.3 Antibody (H00003748-M01)

Learn more about PTMs related to Kv3.3 Antibody (H00003748-M01).

Blogs on Kv3.3

There are no specific blogs for Kv3.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv3.3 Antibody (1C1) and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNC3
Entrez
OMIM
Uniprot