Home » Kv3.3 » Kv3.3 Antibodies » Kv3.3 Antibody (1C1)

Kv3.3 Antibody (1C1)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, RbSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Kv3.3 Antibody (1C1) Summary

Immunogen
KCNC3 (NP_004968, 671 a.a. ~ 757 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Specificity
KCNC3 (1C1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00003748-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv3.3 Antibody (1C1)

  • KSHIIID
  • KV3.3
  • potassium voltage-gated channel subfamily C member 3
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • SCA13
  • Shaw-related voltage-gated potassium channel protein 3
  • spinocerebellar ataxia 13
  • voltage-gated potassium channel protein KV3.3
  • Voltage-gated potassium channel subunit Kv3.3

Background

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Potassium Channel
Kv3.1 Antibody
NBP1-42819
Western Blot: Potassium Channel Kv3.1 Antibody [NBP1-42819] - Membrane preparations from HEK-293 cells untransfected (lane 1), transfected with Kv3.1 (lanes 2 and 4) and transfected with Kv1.2 (lane 3) were subjected to SDS-PAGE and were Western blotted with Kv3.1 Antibody (NBP1-42819). Lane 4 was probed with NBP1-42819 that had been preincubated with the peptide used to generate NBP1-42819.
(2 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, IP, B/N
Kv3.4 Antibody
(S72-16)
NBP1-47609
Western Blot: Kv3.4 Antibody (S72-16) [NBP1-47609] - analysis of Rat brain membrane lysate showing detection of Kv3.4 Potassium Channel protein using Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody, Clone S72-16. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Immunohistochemistry-Paraffin: Kv3.4 Antibody (S72-16) [NBP1-47609] - Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: Hints of filaggrinlike staining.
Immunohistochemistry-Paraffin: Kv3.4 Antibody (S72-16) [NBP1-47609] - Tissue: HaCaT cells. Species: Human. Fixation: Cold 100% methanol for 10 minutes at -20C. Primary Antibody: Mouse Anti-Kv3.4 Potassium Channel Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT. Localization: All cells positive, stains nucleoli.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
Kv3.2 Antibody
(S410-17)
NBP2-59328
Western Blot: Kv3.2 Antibody (S410-17) [NBP2-59328] - Analysis of Mouse, Rat Brain showing detection of ~80-100 kDa Kv3.2 protein using Mouse Anti-Kv3.2 Monoclonal Antibody, Clone S410-17. Lane 1: MW Ladder. Lane 2: Mouse Brain. Lane 3: Rat Brain Membrane.Lane 4: Rat Brain. Load: 20 ug. Block: 2% GE Healthcare Blocker for 1 hour at RT. Primary Antibody: Mouse Anti-Kv3.2 Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:200 for 1 hour at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: ~80-100 kDa. Other Band(s): ~30 kDa for Rat Brain.
Immunocytochemistry/Immunofluorescence: Kv3.2 Antibody (S410-17) [NBP2-59328] - Analysis using Mouse Anti-Kv3.2 Monoclonal Antibody, Clone S410-17. Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Kv3.2 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Cell Membrane. Magnification: 60X. (A) DAPI (blue) nuclear stain (B) Phalloidin Texas Red F-Actin stain (C) Kv3.2 Antibody (D) Composite.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Kv1.4 Antibody
NBP2-75552
Western Blot: Kv1.4 Antibody [NBP2-75552] - Analysis of Kv1.4 on rat brain (1) and mouse brain (2) tissue lysate using anti-Kv1.4 antibody at 1/1,000 dilution.
Immunocytochemistry/Immunofluorescence: Kv1.4 Antibody [NBP2-75552] - Staining Kv1.4 in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Kv1.4 Antibody [NBP2-75552] - Analysis of paraffin-embedded rat brain tissue using anti-Kv1.4 antibody. Counter stained with hematoxylin.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Kv4.2 Antibody
NBP3-03748
Western Blot: Kv4.2 Antibody [NBP3-03748] - Analysis of extracts of various cell lines, using Kv4.2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit.
Immunohistochemistry-Paraffin: Kv4.2 Antibody [NBP3-03748] - Rat model of heart failure post-myocardial infarction, Kv4.2 IHC in infarct region with nuclear counterstain. 60X magnification. IHC-P image submitted by a verified customer review.
Immunohistochemistry-Paraffin: Kv4.2 Antibody [NBP3-03748] - Paraffin-embedded human stomach using Kv4.2 antibody at dilution of 1:100 (40x lens).
(1 Review)
Species: Hu, Rt
Applications: WB, IHC, IHC-P
Kv4.3 Antibody
NBP2-76945
Western Blot: Kv4.3 Antibody [NBP2-76945] - Western blot analysis of Kv4.3 on different lysates using anti-Kv4.3 antibody at 1/1,000 dilution.Positive control:Lane1: MCF-7 Lane2: Mouse marrow
Immunocytochemistry/Immunofluorescence: Kv4.3 Antibody [NBP2-76945] - ICC staining Kv4.3 in MG-63 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry: Kv4.3 Antibody [NBP2-76945] - Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue using anti-Kv4.3 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
KCNB1 Antibody
NBP2-38498
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining of human cerebral cortex shows high expression.
Immunohistochemistry-Paraffin: KCNB1 Antibody [NBP2-38498] - Staining in human cerebral cortex and pancreas tissues using anti-KCNB1 antibody. Corresponding KCNB1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
GAD1/GAD67 Antibody
NBP1-02161
Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Immunocytochemical staining of GAD1/GAD67 (RED/YELLOW) in cultured cortical neurons from a neonatal mouse (C57/Black6). GAD1/GAD67 staining was detected using Texas Red goat anti-chicken IgY. MAP2 staining (GREEN) used a rabbit antibody.
Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Sph21 neuroblastoma cells in culture. Fixed with 4% paraformaldehyde. GAD1/GAD67 (GREEN) immunoreactivity. Phalloidin (F-actin) (RED) staining. DAPI (BLUE) staining.
Immunocytochemistry/Immunofluorescence: GAD1/GAD67 Antibody [NBP1-02161] - Immunohistochemical staining of inhibitory neurons (RED) within the hippocampal formation of a transgenic, adult male Black6 mouse brain. The brains were fixed with 4.0% paraformaldehyde. The green staining is low level GFP fluorescence expressed off the actin promoter in this mouse transgenic strain.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Kv1.5 Antibody
NBP2-76939
Western Blot: Kv1.5 Antibody [NBP2-76939] - Western blot analysis of KCNA5 on PANC-1 cell lysate using anti-KCNA5 antibody at 1:5000 dilution.
Immunocytochemistry/Immunofluorescence: Kv1.5 Antibody [NBP2-76939] - ICC staining KCNA5 in SKOV-3 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X-100, PBS.
Immunohistochemistry-Paraffin: Kv1.5 Antibody [NBP2-76939] - Rodent model of heart failure post-myocardial infarction. 60X micrograph from infarct region. Antibody at 1:1000. Nuclear counterstain. IHC-P image submitted by a verified customer review.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Kv1.2 Antibody
NBP1-42802
Immunocytochemistry/Immunofluorescence: Kv1.2 Antibody [NBP1-42802] - Detection of Kv1.2 (Green) in 293 human embryonic kidney cells using NBP1-42802. Nuclei (Blue) are counterstained using Hoechst 33258.
(3 Publications)
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
Kv1.3 Antibody
(1D8)
H00003738-M01
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8. Analysis of KCNA3 expression in human liver.
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8 Analysis of KCNA3 expression in Hela S3 NE.
Western Blot: Kv1.3 Antibody (1D8) [H00003738-M01] - KCNA3 monoclonal antibody (M01), clone 1D8. Analysis of KCNA3 expression in Jurkat.
Species: Hu
Applications: WB, ELISA
KCNK3 Antibody
(S374-48)
NBP2-42202
Western Blot: KCNK3 Antibody (S374-48) [NBP2-42202] - Analysis of Rat Brain Membrane showing detection of ~50 kDa TASK1 Potassium Channel protein using Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody, Clone S374-48. Lane 1: Molecular Weight Ladder (MW). Lane 2: Rat brain membrane. Load: 15 ug. Block: 2% BSA and 2% Skim Milk in 1X TBST. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:1000 for 16 hours at 4 degrees C. Secondary Antibody: Goat Anti-Mouse IgG: HRP at 1:2000 for 60 min at RT. Color Development: ECL solution for 6 min at RT. Predicted/Observed Size: 50 kDa.
Immunocytochemistry/Immunofluorescence: KCNK3 Antibody (S374-48) [NBP2-42202] - Tissue: Neuroblastoma cell line SK-N-BE. Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-TASK1 Potassium Channel Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:100 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60min RT, 5min RT. Localization: Membrane. Magnification: 60X.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
IP3R1 Antibody
NBP1-21398
Western Blot: IP3R1 Antibody [NBP1-21398] - Whole cell lysate from HeLa cells. Affinity purified rabbit anti-IP3R1 antibody. IP3R1 was also immunoprecipitated by rabbit anti-IP3R1 antibody NBP1-21397.
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-21398] - Section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:100 (2ug/ml). Detection: Red-fluorescent Goat anti-Rabbit IgG-heavy and light chain cross-adsorbed Antibody DyLight 594 Conjugated used ata dilution of 1:100. Counterstain: DAPI (blue).
Immunohistochemistry-Paraffin: IP3R1 Antibody [NBP1-21398] - Section of mouse cerebellum. Antibody: Affinity purified rabbit anti- IP3R1 used at a dilution of 1:200 (1ug/ml). Detection: DAB. Counterstain: IHC Hematoxylin (blue).
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
VGLUT1 Antibody
(CL2754)
NBP2-46627
Immunohistochemistry-Paraffin: VGLUT1 Antibody (CL2754) [NBP2-46627] - VGLUT1 Antibody (2754) [NBP2-46627] - Staining in human cerebral cortex and tonsil tissues. Corresponding VGLUT1 RNA-seq data are presented for the same tissues.
Western Blot: VGLUT1 Antibody (2754) [NBP2-46627] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral Cortex tissue
Immunohistochemistry: VGLUT1 Antibody (2754) [NBP2-46627] - Staining of rat brain shows strong positivity in glutamatergic processes in the molecular and granular layers of cerebellum.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
PKC gamma Antibody
NBP1-58916
Western Blot: PKC gamma Antibody [NBP1-58916] - Human neuroblastoma cells untreated or treated with various drugs. Image from verified customer review.
Chromatin Immunoprecipitation: PKC gamma Antibody [NBP1-58916] - Quiescent human colon carcinoma cultures were treated with 10% FBS for three time points (0, 15, 30min) or (0, 30, 60min) were used in Matrix-ChIP and real-time PCR assays at EGR1 gene (Exon1) and 15kb upstream site.
Western Blot: PKC gamma Antibody [NBP1-58916] - Human Placenta lysate, concentration 0.2-1 ug/ml.
(1 Review)
Species: Hu
Applications: WB, ChIP, ICC/IF, ChIP
Tau tubulin kinase
2 Antibody
NBP1-92476
Western Blot: Tau tubulin kinase 2 Antibody [NBP1-92476] - Analysis in control (vector only transfected HEK293T lysate) and TTBK2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Tau tubulin kinase 2 Antibody [NBP1-92476] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Spectrin beta 3
Antibody
NB110-58346
Western Blot: Spectrin beta 3 Antibody [NB110-58346] - Detection of Human Spectrin beta 3 on HeLa whole cell lysates using NB110-58346. Spectrin beta 3 was also immunoprecipitated by rabbit anti-Spectrin beta 3 antibody NB110-58783.
Immunohistochemistry-Paraffin: Spectrin beta 3 Antibody [NB110-58346] - Detection of Spectrin beta 3 in human prostate epithelium.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
FGF14 Antibody
NBP3-04588
Western Blot: FGF14 Antibody [NBP3-04588] - Analysis of extracts of various cell lines, using FGF14 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit
Immunocytochemistry/Immunofluorescence: FGF14 Antibody [NBP3-04588] - Analysis of U2OS cells using FGF14 antibody.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Kv4.1 Antibody
NBP1-81336
Western Blot: Kv4.1 Antibody [NBP1-81336] - Analysis in control (vector only transfected HEK293T lysate) and KCND1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Kv4.1 Antibody [NBP1-81336] - Staining of human cerebellum shows moderate positivity in granular layer.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Kv3.3 Antibody
(1C1)
H00003748-M01
Kv3.3 Antibody (1C1)
Species: Hu, Mu, Rb
Applications: WB, ELISA, ICC/IF

Publications for Kv3.3 Antibody (H00003748-M01)(1)


Reviews for Kv3.3 Antibody (H00003748-M01) (0)

There are no reviews for Kv3.3 Antibody (H00003748-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kv3.3 Antibody (H00003748-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Kv3.3 Products

Bioinformatics Tool for Kv3.3 Antibody (H00003748-M01)

Discover related pathways, diseases and genes to Kv3.3 Antibody (H00003748-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.3 Antibody (H00003748-M01)

Discover more about diseases related to Kv3.3 Antibody (H00003748-M01).
 

Pathways for Kv3.3 Antibody (H00003748-M01)

View related products by pathway.

PTMs for Kv3.3 Antibody (H00003748-M01)

Learn more about PTMs related to Kv3.3 Antibody (H00003748-M01).

Blogs on Kv3.3

There are no specific blogs for Kv3.3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv3.3 Antibody (1C1) and receive a gift card or discount.


Bioinformatics

Gene Symbol KCNC3
Entrez
OMIM
Uniprot