Kv3.3 Antibody (1C1) (H00003748-M01)

Images

 
Western Blot: Kv3.3 Antibody (1C1) [H00003748-M01] - KCNC3 monoclonal antibody (M01), clone 1C1 Analysis of KCNC3 expression in NIH/3T3.
Immunocytochemistry/ Immunofluorescence: Kv3.3 Antibody (1C1) [H00003748-M01] - Analysis of monoclonal antibody to KCNC3 on NIH/3T3 cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1C1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Kv3.3 Antibody (1C1) Summary

Immunogen
KCNC3 (NP_004968 671 a.a. - 757 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ALAHEDCPAIDQPAMSPEDKSPITPGSRGRYSRDRACFLLTDYAPSPDGSIRKATGAPPLPPQDWRKPGPPSFLPDLNANAAAWISP
Specificity
KCNC3 (1C1)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
KCNC3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IF and ELISA.
Publications
Read Publication using H00003748-M01.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kv3.3 Antibody (1C1)

  • KSHIIID
  • KV3.3
  • potassium voltage-gated channel subfamily C member 3
  • potassium voltage-gated channel, Shaw-related subfamily, member 3
  • SCA13
  • Shaw-related voltage-gated potassium channel protein 3
  • spinocerebellar ataxia 13
  • voltage-gated potassium channel protein KV3.3
  • Voltage-gated potassium channel subunit Kv3.3

Background

The Shaker gene family of Drosophila encodes components of voltage-gated potassium channels and is comprised of four subfamilies. Based on sequence similarity, this gene is similar to one of these subfamilies, namely the Shaw subfamily. The protein encoded by this gene belongs to the delayed rectifier class of channel proteins and is an integral membrane protein that mediates the voltage-dependent potassium ion permeability of excitable membranes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-42819
Species: Hu, Mu, Rt, Bv, Ca, Rb
Applications: WB, B/N, IP
NBP1-47609
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59328
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP2-19315
Species: Hu
Applications: WB
NBP2-38498
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP1-42802
Species: Hu, Mu, Rt, Po, Bv, Ca, Xp, Ze
Applications: WB, ICC/IF, IP
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP2-42202
Species: Rt
Applications: WB, ICC/IF, IHC, ICC
NBP1-21398
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46627
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF5130
Species: Hu, Mu, Rt
Applications: WB
NBP1-92476
Species: Hu
Applications: IHC, IHC-P
NB110-58346
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-55745
Species: Hu
Applications: ICC/IF
NBP1-81336
Species: Hu
Applications: WB, IHC, IHC-P
H00003748-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for Kv3.3 Antibody (H00003748-M01)(1)

Reviews for Kv3.3 Antibody (H00003748-M01) (0)

There are no reviews for Kv3.3 Antibody (H00003748-M01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Kv3.3 Antibody (H00003748-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kv3.3 Products

Related Products by Gene

Bioinformatics Tool for Kv3.3 Antibody (H00003748-M01)

Discover related pathways, diseases and genes to Kv3.3 Antibody (H00003748-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kv3.3 Antibody (H00003748-M01)

Discover more about diseases related to Kv3.3 Antibody (H00003748-M01).
 

Pathways for Kv3.3 Antibody (H00003748-M01)

View related products by pathway.

PTMs for Kv3.3 Antibody (H00003748-M01)

Learn more about PTMs related to Kv3.3 Antibody (H00003748-M01).

Blogs on Kv3.3

There are no specific blogs for Kv3.3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kv3.3 Antibody (1C1) and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNC3
Entrez
OMIM
Uniprot