![Western Blot: Potassium channel subfamily K member 6 Antibody [NBP2-93795] - Analysis of extracts of various cell lines, using Potassium channel subfamily K member 6 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.](http://images.novusbio.com/fullsize/Potassium-channel-subfamily-K-member-6-Antibody-Western-Blot-NBP2-93795-img0001.jpg "Western Blot: Potassium channel subfamily K member 6 Antibody [NBP2-93795] - Analysis of extracts of various cell lines, using Potassium channel subfamily K member 6 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit Potassium channel subfamily K member 6 Antibody - Azide and BSA Free (NBP2-93795) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 254-313 of human KCNK6 (NP_004814.1). QTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDYASIPR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KCNK6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Potassium channel subfamily K member 6 Antibody (NBP2-93795)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KCNK6 |
![N/A IL-13 [Biotin]](https://images.novusbio.com/images2/DATA_IL13_DY413_ELISA_2010.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")