![Western Blot: KCNK9 Antibody [NBP2-84109] - Host: Rabbit. Target Name: KCNK9. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/fullsize/KCNK9-Antibody-Western-Blot-NBP2-84109-img0003.jpg "Western Blot: KCNK9 Antibody [NBP2-84109] - Host: Rabbit. Target Name: KCNK9. Sample Tissue: Human 293T. Antibody Dilution: 1.0ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | Novus Biologicals Rabbit KCNK9 Antibody - BSA Free (NBP2-84109) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK9. Peptide sequence: REEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEPHRAGVQWKFAGSFY The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KCNK9 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for KCNK9 Antibody (NBP2-84109)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KCNK9 |
![Immunohistochemistry: KCNK9 Antibody [NBP2-84109]](http://images.novusbio.com/fullsize/KCNK9-Antibody-Immunohistochemistry-NBP2-84109-img0005.jpg "Immunohistochemistry: KCNK9 Antibody [NBP2-84109]")
![Western Blot: KCNK9 Antibody [NBP2-84109] - Host: Rabbit. Target Name: KCNK9. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/KCNK9-Antibody-Western-Blot-NBP2-84109-img0004.jpg "Western Blot: KCNK9 Antibody [NBP2-84109] - Host: Rabbit. Target Name: KCNK9. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml")
![Immunohistochemistry: KCNK9 Antibody [NBP2-84109] - Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody](http://images.novusbio.com/fullsize/KCNK9-Antibody-Immunohistochemistry-NBP2-84109-img0001.jpg "Immunohistochemistry: KCNK9 Antibody [NBP2-84109] - Immunohistochemistry with prostate cell lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody")
![Immunohistochemistry: KCNK9 Antibody [NBP2-84109] - Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody](http://images.novusbio.com/fullsize/KCNK9-Antibody-Immunohistochemistry-NBP2-84109-img0002.jpg "Immunohistochemistry: KCNK9 Antibody [NBP2-84109] - Immunohistochemistry with Human Prostate lysate tissue at an antibody concentration of 5.0ug/ml using anti-KCNK9 antibody")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
