KCNK5 Antibody


Immunocytochemistry/ Immunofluorescence: KCNK5 Antibody [NBP2-32432] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Immunohistochemistry-Paraffin: KCNK5 Antibody [NBP2-32432] - Staining of human kidney shows positivity in a subset of renal tubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KCNK5 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: VPLVVYSKNRVPTLEEVSQTLRSKGHVSRSPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLI
Specificity of human KCNK5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCNK5 Protein (NBP2-32432PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KCNK5 Antibody

  • Acid-sensitive potassium channel protein TASK-2
  • FLJ11035
  • K2p5.1
  • potassium channel subfamily K member 5
  • potassium channel, subfamily K, member 1 (TASK-2)
  • potassium channel, subfamily K, member 5
  • TASK-2
  • TASK2K2P5.1 potassium channel
  • TWIK-related acid-sensitive K(+) channel 2
  • TWIK-related acid-sensitive K+ channel 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Species: Hu, Mu, Bv
Applications: ICC/IF (-), IHC (-), WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, RNAi
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, PAGE
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, KO
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for KCNK5 Antibody (NBP2-32432) (0)

There are no publications for KCNK5 Antibody (NBP2-32432).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KCNK5 Antibody (NBP2-32432) (0)

There are no reviews for KCNK5 Antibody (NBP2-32432). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNK5 Antibody (NBP2-32432) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KCNK5 Products

Bioinformatics Tool for KCNK5 Antibody (NBP2-32432)

Discover related pathways, diseases and genes to KCNK5 Antibody (NBP2-32432). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNK5 Antibody (NBP2-32432)

Discover more about diseases related to KCNK5 Antibody (NBP2-32432).

Pathways for KCNK5 Antibody (NBP2-32432)

View related products by pathway.

PTMs for KCNK5 Antibody (NBP2-32432)

Learn more about PTMs related to KCNK5 Antibody (NBP2-32432).

Blogs on KCNK5

There are no specific blogs for KCNK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCNK5 Antibody and receive a gift card or discount.


Gene Symbol KCNK5