Immunocytochemistry/ Immunofluorescence: KCNJ15 Antibody [NBP1-83091] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry: KCNJ15 Antibody [NBP1-83091] - Protein expression alterations in PanIN and pancreatic adenocarcinoma. Representative immunohistochemistry images of normal pancreatic duct, PanINs and pancreatic ...read more
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human kidney shows strong membranous/cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human prostate strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human stomach shows strong membranous/cytoplasmic positivity in glandular cells.
Protein expression alterations in PanIN and pancreatic adenocarcinomaLeft, Representative immunohistochemistry images of normal pancreatic duct, PanINs and pancreatic cancer tissues for: Gata4, Kcnj15 and Reg4. Scale ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ15
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
potassium inwardly-rectifying channel, subfamily J, member 15
Background
Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our KCNJ15 Antibody - BSA Free and receive a gift card or discount.