KCNJ15 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: KCNJ15 Antibody [NBP1-83091] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry: KCNJ15 Antibody [NBP1-83091] - Protein expression alterations in PanIN and pancreatic adenocarcinoma. Representative immunohistochemistry images of normal pancreatic duct, PanINs and pancreatic ...read more
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human kidney shows strong membranous/cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human prostate strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human stomach shows strong membranous/cytoplasmic positivity in glandular cells.
Protein expression alterations in PanIN and pancreatic adenocarcinomaLeft, Representative immunohistochemistry images of normal pancreatic duct, PanINs and pancreatic cancer tissues for: Gata4, Kcnj15 and Reg4. Scale ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

KCNJ15 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit KCNJ15 Antibody - BSA Free (NBP1-83091) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-KCNJ15 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNJ15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCNJ15 Protein (NBP1-83091PEP)
Publications
Read Publications using
NBP1-83091 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KCNJ15 Antibody - BSA Free

  • inward rectifier K+ channel KIR4.2
  • inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15
  • inwardly rectifying subfamily J member 15
  • KCNJ14
  • Kir1.3
  • Kir4.2
  • MGC13584
  • potassium inwardly-rectifying channel, subfamily J, member 15

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP1-82874
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P
NB100-74575
Species: Hu
Applications: ICC/IF, IHC, PEP-ELISA, WB
NBP3-46384
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP2-12900
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, MiAr, WB
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP3-03005
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-57515
Species: Hu
Applications: IHC,  IHC-P
NBP3-46381
Species: Hu
Applications: ELISA, IHC, WB
NBP1-84294
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59324
Species: Ma, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-88081
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-87693
Species: Hu
Applications:  IHC-P, WB
NB110-41622
Species: Bv, Ch, Gt, Hu, Mu, Po, Rt, Xp
Applications: IHC,  IHC-P, WB
NBP1-54331
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38146
Species: Hu
Applications: IHC,  IHC-P
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB

Publications for KCNJ15 Antibody (NBP1-83091)(3)

Reviews for KCNJ15 Antibody (NBP1-83091) (0)

There are no reviews for KCNJ15 Antibody (NBP1-83091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNJ15 Antibody (NBP1-83091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KCNJ15 Products

Research Areas for KCNJ15 Antibody (NBP1-83091)

Find related products by research area.

Blogs on KCNJ15

There are no specific blogs for KCNJ15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KCNJ15 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNJ15