KCNJ15 Antibody

Immunocytochemistry/Immunofluorescence: KCNJ15 Antibody [NBP1-83091] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.

Immunohistochemistry: KCNJ15 Antibody [NBP1-83091] - Protein expression alterations in PanIN and pancreatic adenocarcinoma. Representative immunohistochemistry images of normal pancreatic duct, PanINs and pancreatic cancer tissues for: Gata4, Kcnj15 and Reg4. Scale bar is 50 um. Right, Number of tumor microarray cores at each labeling score (negative, weak, or strong). Image collected and cropped by CiteAb from the following publication (//www.oncotarget.com/fulltext/19848), licensed under a CC-BY licence.

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human Fallopian tube shows strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human kidney shows strong membranous/cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human prostate strong membranous positivity in glandular cells.

Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human stomach shows strong membranous/cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

KCNJ15 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ15
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: IHC reported in scientific literature (PMID: 29137350). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KCNJ15 Protein (NBP1-83091PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KCNJ15 Antibody

• inward rectifier K+ channel KIR4.2
• inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15
• inwardly rectifying subfamily J member 15
• KCNJ14
• Kir1.3
• Kir4.2
• MGC13584
• potassium inwardly-rectifying channel, subfamily J, member 15

Background

Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Three transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KCNJ15 Antibody (NBP1-83091)(2)

Publications using NBP1-83091

• Ayars M, O'Sullivan E, Macgregor-Das A et al. IL2RG, identified as overexpressed by RNA-seq profiling of pancreatic intraepithelial neoplasia, mediates pancreatic cancer growth Oncotarget. 2017 Oct 13 [PMID: 29137350] (IHC)
• He W, Liu W, Chew CS et al. Acid secretion-associated translocation of KCNJ15 in gastric parietal cells. Am J Physiol Gastrointest Liver Physiol 2011 Oct [PMID: 21719736]

Bioinformatics

• Gene Symbol: KCNJ15