KCNJ15 Antibody


Immunocytochemistry/ Immunofluorescence: KCNJ15 Antibody [NBP1-83091] - Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: KCNJ15 Antibody [NBP1-83091] - Staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KCNJ15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SAVCQSRTSYIPEEIYWGFEFVPVVSLSKNGKYVADFSQFEQIRKSPDCTFYCADSEKQQLEEKYRQEDQRERELRTL
Specificity of human KCNJ15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KCNJ15 Protein (NBP1-83091PEP)
Read Publications using NBP1-83091.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KCNJ15 Antibody

  • inward rectifier K+ channel KIR4.2
  • inwardly rectifing potassium channel Kir4.210ATP-sensitive inward rectifier potassium channel 15
  • inwardly rectifying subfamily J member 15
  • KCNJ14
  • Kir1.3
  • Kir4.2
  • MGC13584
  • potassium inwardly-rectifying channel, subfamily J, member 15


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for KCNJ15 Antibody (NBP1-83091)(2)

Reviews for KCNJ15 Antibody (NBP1-83091) (0)

There are no reviews for KCNJ15 Antibody (NBP1-83091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KCNJ15 Antibody (NBP1-83091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional KCNJ15 Products

Bioinformatics Tool for KCNJ15 Antibody (NBP1-83091)

Discover related pathways, diseases and genes to KCNJ15 Antibody (NBP1-83091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KCNJ15 Antibody (NBP1-83091)

Discover more about diseases related to KCNJ15 Antibody (NBP1-83091).

Pathways for KCNJ15 Antibody (NBP1-83091)

View related products by pathway.

Blogs on KCNJ15

There are no specific blogs for KCNJ15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KCNJ15 Antibody and receive a gift card or discount.


Gene Symbol KCNJ15