MUPP1 Antibody

Images

 
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPDZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUPP1 Protein (NBP1-87839PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87839 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUPP1 Antibody

  • DKFZp781P216
  • FLJ25909
  • FLJ90240
  • Multi-PDZ domain protein 1
  • multiple PDZ domain protein
  • MUPP1FLJ34626

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85047
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P, ICC
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF7979
Species: Hu, Mu, Rt
Applications: WB
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-34046
Species: Hu
Applications: WB, IHC, IHC-P
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009076-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF7829
Species: Hu
Applications: WB, IHC, ICC
H00154796-B01P
Species: Hu, Rt
Applications: WB, ELISA
NBP2-41187
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00057449-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-59254
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-81185
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91809
Species: Hu
Applications: IHC, IHC-P

Publications for MUPP1 Antibody (NBP1-87839) (0)

There are no publications for MUPP1 Antibody (NBP1-87839).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MUPP1 Antibody (NBP1-87839) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Canine, Pig, Mouse, Human.
We have 1 review tested in 1 application: WB.

Reviews using NBP1-87839:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Canine, Pig, Mouse, Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MUPP1 NBP1-87839
Enlarge
reviewed by:
Anonymous
WB Canine, Pig, Mouse, Human 10/10/2017
View

Summary

ApplicationWestern Blot
Sample Tested293 cell extract,canine kidney tissue culture cells (= MDCK cells),Caco-2 cell line,HUVEC,EA.hy926 cell lysates,LLC-PK1 cells,porcine aortic endothelial cells
SpeciesCanine, Pig, Mouse, Human
LotA96400

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUPP1 Antibody (NBP1-87839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUPP1 Products

MUPP1 NBP1-87839

Bioinformatics Tool for MUPP1 Antibody (NBP1-87839)

Discover related pathways, diseases and genes to MUPP1 Antibody (NBP1-87839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUPP1 Antibody (NBP1-87839)

Discover more about diseases related to MUPP1 Antibody (NBP1-87839).
 

Pathways for MUPP1 Antibody (NBP1-87839)

View related products by pathway.

PTMs for MUPP1 Antibody (NBP1-87839)

Learn more about PTMs related to MUPP1 Antibody (NBP1-87839).
 

Research Areas for MUPP1 Antibody (NBP1-87839)

Find related products by research area.

Blogs on MUPP1

There are no specific blogs for MUPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Anonymous
10/10/2017
Application: WB
Species: Canine, Pig, Mouse, Human

Bioinformatics

Gene Symbol MPDZ