Home » MUPP1 » MUPP1 Antibodies » MUPP1 Antibody

MUPP1 Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MUPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
Specificity
Specificity of human MUPP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPDZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUPP1 Protein (NBP1-87839PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87839 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUPP1 Antibody

  • DKFZp781P216
  • FLJ25909
  • FLJ90240
  • Multi-PDZ domain protein 1
  • multiple PDZ domain protein
  • MUPP1FLJ34626

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining in human testis and skeletal muscle tissues. Corresponding TJP1 RNA-seq data are presented for the same tissues.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. Image from verified customer review.
(4 Reviews)
(1 Publication)
Species: Hu, Po
Applications: Simple Western, ICC/IF, IHC, IHC-P
PATJ Antibody
NB100-1354
Immunohistochemistry-Paraffin: PATJ Antibody [NB100-1354] - 3.8ug/ml staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
PALS1/MPP5 Antibody
AF7979
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, MCF‑7 human breast cancer cell line, bEnd.3 mouse endothelioma cell line, and Rat‑2 rat embryonic fibroblast cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human/Mouse/Rat PALS1/MPP5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7979) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for PALS1/MPP5 at approximately 75-80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu, Mu, Rt
Applications: WB
PSD-95 Antibody
(6G6-1C9)
NB300-556
Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.
Immunocytochemistry: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
SynGAP Antibody
NBP1-87841
Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NBP1-87841] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: SynGAP Antibody [NBP1-87841] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: SynGAP Antibody [NBP1-87841] - Staining of human hippocampus shows positivity in neuronal processes.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
PSD-95 Antibody
(6G6-1C9)
NB300-556
Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.
Immunocytochemistry: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(12 Publications)
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in A-431.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 5 ug/ml.
Western Blot: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - CLDN1 monoclonal antibody (M01), clone 1C5-D9. Analysis of CLDN1 expression in PRC/PRF/5.
(1 Review)
(19 Publications)
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
DLG1 Antibody
NB600-1229
Western Blot: DLG1 Antibody [NB600-1229] - Analysis of 25 ug of C6 (lane 1), PC12 (lane 2) and rat brain (lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of NIH-3T3 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Afadin/AF-6
Antibody [Unconjugate
AF7829
Western blot shows lysates of HEK293T human embryonic kidney cell line and SK‑OV‑3 human ovarian adenocarcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Afadin/AF-6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7829) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Afadin/AF-6 at approximately 220 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Afadin/AF-6 was detected in immersion fixed BEAS2B human lung epithelial cell line using Sheep Anti-Human Afadin/AF-6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7829) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Afadin/AF-6 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Sheep Anti-Human Afadin/AF-6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7829) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC, ICC
AMOT Antibody
H00154796-B01P
Western Blot: AMOT Antibody [H00154796-B01P] - Analysis of AMOT expression in transfected 293T cell line by AMOT polyclonal antibody. Lane 1: AMOT transfected lysate(74.25 KDa). Lane 2: Non-transfected lysate.
Western Blot: AMOT Antibody [H00154796-B01P] - analysis of AMOT expression in transfected 293T cell line by AMOT purified MaxPab polyclonal antibody (B01P). Lane 1: AMOT transfected lysate (72.50 KDa). Lane 2: Non-transfected lysate.
Western Blot: AMOT Antibody [H00154796-B01P] - AMOT MaxPab polyclonal antibody. Western Blot analysis of AMOT expression in rat brain.
(3 Publications)
Species: Hu, Rt
Applications: WB, ELISA
Claudin-4 Antibody
NBP2-41187
Western Blot: Claudin-4 Antibody [NBP2-41187] - Analysis of CLAUDIN4 in HeLa cell lysate with CLAUDIN4 antibody at 0.5 ug/mL.
Immunocytochemistry/Immunofluorescence: Claudin-4 Antibody [NBP2-41187] - Immunofluorescence of CLAUDIN4 in human colon tissue with CLAUDIN4 antibody at 20 ug/mL.
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
MAGI1 Antibody
(7B4)
H00009223-M03
Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).
Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Western Blot: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Guanylate kinase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Guanylate kinase.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody (4A8) [NBP2-00594] Staining of paraffin-embedded Human prostate tissue using anti-Guanylate kinase mouse monoclonal antibody.
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PLEKHG5 Antibody
(5A9)
H00057449-M01
Immunocytochemistry/Immunofluorescence: PLEKHG5 Antibody (5A9) [H00057449-M01] - Analysis of monoclonal antibody to PLEKHG5 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PLEKHG5 Antibody (5A9) [H00057449-M01] - Analysis of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.
ELISA: PLEKHG5 Antibody (5A9) [H00057449-M01] - Detection limit for recombinant GST tagged PLEKHG5 is approximately 0.3ng/ml as a capture antibody.
(3 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TJP3 Antibody
NBP2-38696
Immunocytochemistry/Immunofluorescence: TJP3 Antibody [NBP2-38696] - Staining of human cell line CACO-2 shows positivity in cell junctions and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human fallopian tube shows moderate cell membrane positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Connexin 36/GJD2
Antibody
NBP1-59254
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat
Immunohistochemistry-Frozen: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody NBP1-59254 was used at a concentration of 1ug/mL (along with Parvalbumin antibody for double staining) with gentle shaking and overnight incubation at 4C. For the detection of NBP1-59254 primary, anti-rabbit Alexa 555 secondary was employed and images were captured using a confocal microscope at 63X resolution.
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
CRB3 Antibody
NBP1-81185
Immunocytochemistry/Immunofluorescence: CRB3 Antibody [NBP1-81185] - Immunofluorescent staining of human cell line U-2 OS shows localization to cell junctions.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human kidney shows strong membranous positivity in cells of glomeruli.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
CRB2 Antibody
NBP1-91809
Immunohistochemistry-Paraffin: CRB2 Antibody [NBP1-91809] - Staining of human kidney shows strong membranous and cytoplasmic positivity in cells in glomeruli.
Species: Hu
Applications: IHC, IHC-P
Claudin-7 Antibody
NBP1-85683
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP1-85683] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP1-85683] - Staining of human rectum shows high expression.
Immunohistochemistry-Paraffin: Claudin-7 Antibody [NBP1-85683] - Staining in human rectum and skeletal muscle tissues using anti-CLDN7 antibody. Corresponding CLDN7 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
MUPP1 Antibody
NBP1-87839
MUPP1 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for MUPP1 Antibody (NBP1-87839) (0)

There are no publications for MUPP1 Antibody (NBP1-87839).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MUPP1 Antibody (NBP1-87839) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Canine, Pig, Mouse, Human.

Reviews using NBP1-87839:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Canine, Pig, Mouse, Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MUPP1 NBP1-87839
Enlarge
reviewed by:
Anonymous
 WB Canine, Pig, Mouse, Human 10/10/2017
View

Summary

ApplicationWestern Blot
Sample Tested293 cell extract,canine kidney tissue culture cells (= MDCK cells),Caco-2 cell line,HUVEC,EA.hy926 cell lysates,LLC-PK1 cells,porcine aortic endothelial cells
SpeciesCanine, Pig, Mouse, Human
LotA96400

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUPP1 Antibody (NBP1-87839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUPP1 Products

MUPP1 NBP1-87839

Bioinformatics Tool for MUPP1 Antibody (NBP1-87839)

Discover related pathways, diseases and genes to MUPP1 Antibody (NBP1-87839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUPP1 Antibody (NBP1-87839)

Discover more about diseases related to MUPP1 Antibody (NBP1-87839).
 

Pathways for MUPP1 Antibody (NBP1-87839)

View related products by pathway.

PTMs for MUPP1 Antibody (NBP1-87839)

Learn more about PTMs related to MUPP1 Antibody (NBP1-87839).
 

Research Areas for MUPP1 Antibody (NBP1-87839)

Find related products by research area.

Blogs on MUPP1

There are no specific blogs for MUPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot MUPP1 NBP1-87839
Enlarge
 Anonymous
10/10/2017
Application: WB
Species: Canine, Pig, Mouse, Human
read this review

Bioinformatics

Gene Symbol MPDZ