MUPP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MUPP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MPDZ
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  MUPP1 Protein (NBP1-87839PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for MUPP1 Antibody - BSA Free

• DKFZp781P216
• FLJ25909
• FLJ90240
• Multi-PDZ domain protein 1
• multiple PDZ domain protein
• MUPP1FLJ34626

Background

Function: Interacts with HTR2C and provokes its clustering at the cell surface. Member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.; Subcellular location: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Apical cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, dendrite. Cell junction, synapse. Cell junction, tight junction. Cell junction, synapse. Cell junction, synapse, synaptosome. Note: Associated with membranes. Colocalizes with HTR2C on the apical membrane of epithelial choroid plexus cells. Highly enriched in postsynaptic densities (PSD). Localized to punctae on dendrites of hippocampal neurons and colocalizes with the synaptic marker DLG4. Localized mainly in the Schmidt-Lanterman incisures of myelinating Schwann cells. In the retina, localizes to the sub-apical region adjacent to the adherens junction complex at the outer limiting membrane. Enriched at the tight junctions of epithelial cells. Association to the tight junctions depends on CXADR.; Tissue specificity: Expressed in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for MUPP1 Antibody (NBP1-87839) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Canine, Human, Mouse, Pig.

reviewed by: Verified Customer WB Canine, Human, Mouse, Pig 10/10/2017

Summary

• Application: Western Blot
• Sample Tested: 293 cell extract,Caco-2 cell line,canine kidney tissue culture cells (= MDCK cells),EA.hy926 cell lysates,HUVEC,LLC-PK1 cells,porcine aortic endothelial cells
• Species: Canine, Human, Mouse, Pig
• Lot: A96400

Bioinformatics

• Gene Symbol: MPDZ