MUPP1 Antibody

Images

 
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MUPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPDZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUPP1 Protein (NBP1-87839PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87839 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUPP1 Antibody

  • DKFZp781P216
  • FLJ25909
  • FLJ90240
  • Multi-PDZ domain protein 1
  • multiple PDZ domain protein
  • MUPP1FLJ34626

Background

Function: Interacts with HTR2C and provokes its clustering at the cell surface. Member of the NMDAR signaling complex that may play a role in control of AMPAR potentiation and synaptic plasticity in excitatory synapses.; Subcellular location: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Apical cell membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction, synapse, postsynaptic cell membrane, postsynaptic density. Cell projection, dendrite. Cell junction, synapse. Cell junction, tight junction. Cell junction, synapse. Cell junction, synapse, synaptosome. Note: Associated with membranes. Colocalizes with HTR2C on the apical membrane of epithelial choroid plexus cells. Highly enriched in postsynaptic densities (PSD). Localized to punctae on dendrites of hippocampal neurons and colocalizes with the synaptic marker DLG4. Localized mainly in the Schmidt-Lanterman incisures of myelinating Schwann cells. In the retina, localizes to the sub-apical region adjacent to the adherens junction complex at the outer limiting membrane. Enriched at the tight junctions of epithelial cells. Association to the tight junctions depends on CXADR.; Tissue specificity: Expressed in heart, brain, placenta, liver, skeletal muscle, kidney and pancreas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MUPP1 Antibody (NBP1-87839) (0)

There are no publications for MUPP1 Antibody (NBP1-87839).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MUPP1 Antibody (NBP1-87839) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Canine, Human, Mouse, Pig.

Reviews using NBP1-87839:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Canine, Human, Mouse, Pig
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MUPP1 NBP1-87839
Enlarge
4
reviewed by:
Verified Customer
WB Canine, Human, Mouse, Pig 10/10/2017
View

Summary

ApplicationWestern Blot
Sample Tested293 cell extract,Caco-2 cell line,canine kidney tissue culture cells (= MDCK cells),EA.hy926 cell lysates,HUVEC,LLC-PK1 cells,porcine aortic endothelial cells
SpeciesCanine, Human, Mouse, Pig
LotA96400

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUPP1 Antibody (NBP1-87839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUPP1 Products

Array NBP1-87839

Research Areas for MUPP1 Antibody (NBP1-87839)

Find related products by research area.

Blogs on MUPP1

There are no specific blogs for MUPP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Verified Customer
10/10/2017
Application: WB
Species: Canine, Human, Mouse, Pig

Bioinformatics

Gene Symbol MPDZ