Home » MUPP1 » MUPP1 Antibodies » MUPP1 Antibody

MUPP1 Antibody

 (1 Review)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: MUPP1 Antibody [NBP1-87839] - Staining of human stomach shows strong membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MUPP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MPDZ
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MUPP1 Protein (NBP1-87839PEP)
Reviewed Applications
Read 1 Review rated 4
using
NBP1-87839 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MUPP1 Antibody

  • DKFZp781P216
  • FLJ25909
  • FLJ90240
  • Multi-PDZ domain protein 1
  • multiple PDZ domain protein
  • MUPP1FLJ34626

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Tight Junction
Protein 1 Antibody
NBP1-85047
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of Pig trabecular meshwork cells. ICC/IF image submitted by a verified customer review.
Immunocytochemistry/Immunofluorescence: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human cell line U-2 OS shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Tight Junction Protein 1 Antibody [NBP1-85047] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.
(5 Reviews)
(12 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
PATJ Antibody
NB100-1354
Immunofluorescence: PATJ Antibody [NB100-1354] - Analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing junctional staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
Flow Cytometry: PATJ Antibody [NB100-1354] - Analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(1 Publication)
Species: Hu
Applications: Flow, IF, PEP-ELISA
PALS1/MPP5 Antibody
NB300-952
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NB300-952] - Staining of paraffin embedded Human Small Intestine. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: PALS1/MPP5 Antibody [NB300-952] - Staining of paraffin embedded Human Kidney. Antibody at 5 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunocytochemistry/Immunofluorescence: PALS1/MPP5 Antibody [NB300-952] - Immunofluorescence analysis of paraformaldehyde fixed U2OS cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing nuclear, plasma membrane and cytoplasmic staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
(1 Review)
(25 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SynGAP Antibody
NB120-3344
Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NB120-3344] - Rat hippocampal neurons
Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NB120-3344]
Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NB120-3344] - Immunofluorescence analysis of SynGAP was performed using 70% confluent log phase PC-12 cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
(1 Review)
(25 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Claudin-1 Antibody
(1C5-D9)
H00009076-M01
ELISA: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Detection limit for recombinant GST tagged CLDN1 is approximately 0.03ng/ml as a capture antibody.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Immunohistochemistry-Paraffin: Claudin-1 Antibody (1C5-D9) [H00009076-M01] - Analysis of monoclonal antibody to CLDN1 on formalin-fixed paraffin-embedded human colon. Antibody concentration 5 ug/ml.
(2 Reviews)
(25 Publications)
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
DLG1 Antibody
NB600-1229
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of NIH-3T3 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Western Blot: DLG1 Antibody [NB600-1229] - Analysis of 25 ug of C6 (lane 1), PC12 (lane 2) and rat brain (lane 3) cell lysates.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
Afadin/AF-6
Antibody [Unconjugate
AF7829
Western blot shows lysates of HEK293T human embryonic kidney cell line and SK‑OV‑3 human ovarian adenocarcinoma cell line. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human Afadin/AF-6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7829) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Afadin/AF-6 at approximately 220 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Afadin/AF-6 was detected in immersion fixed paraffin-embedded sections of human brain (hippocampus) using Sheep Anti-Human Afadin/AF-6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7829) at 3 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies and processes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Afadin/AF-6 was detected in immersion fixed BEAS2B human lung epithelial cell line using Sheep Anti-Human Afadin/AF-6 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7829) at 1.7 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC, IHC, WB
AMOT Antibody
(OTI1A8) - Azide and ...
NBP2-72429
Western Blot: AMOT Antibody (OTI1A8) - Azide and BSA Free [NBP2-72429] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY AMOT.
Immunocytochemistry/Immunofluorescence: AMOT Antibody (OTI1A8) - Azide and BSA Free [NBP2-72429] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY AMOT.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Claudin-4 Antibody
(382321) [Unconjugate ...
MAB4219
PC‑3 human prostate cancer cell line was stained with Mouse Anti-Human Claudin‑4 Monoclonal Antibody (Catalog # MAB4219, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram) followed by PE-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0102B). View our protocol for Staining Membrane-associated Proteins.
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow
MAGI1 Antibody
(7B4)
H00009223-M03
ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.
Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml
Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).
(3 Publications)
Species: Ca, Ha, Hu, Rt
Applications: ELISA, ICC/IF, WB
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - Analysis of Hela cells, using anti-Guanylate kinase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - Analysis of Jurkat cells, using anti-Guanylate kinase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
PLEKHG5 Antibody
(5A9)
H00057449-M01
Immunocytochemistry/Immunofluorescence: PLEKHG5 Antibody (5A9) [H00057449-M01] - Analysis of monoclonal antibody to PLEKHG5 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PLEKHG5 Antibody (5A9) [H00057449-M01] - Analysis of monoclonal antibody to PLEKHG5 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.
ELISA: PLEKHG5 Antibody (5A9) [H00057449-M01] - Detection limit for recombinant GST tagged PLEKHG5 is approximately 0.3ng/ml as a capture antibody.
(4 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
TJP3 Antibody
NBP2-38696
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human fallopian tube shows moderate cell membrane positivity in glandular cells.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining of human prostate shows low expression as expected.
Immunohistochemistry-Paraffin: TJP3 Antibody [NBP2-38696] - Staining in human fallopian tube and prostate tissues using anti-TJP3 antibody. Corresponding TJP3 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Connexin 36/GJD2
Antibody
NBP1-59254
Immunohistochemistry-Frozen: Connexin 36/GJD2 Antibody [NBP1-59254] - IHC detection of Connexin 36/GJA9 in 50uM thick section of Mouse Brain. The tissues were pre-fixed overnight in 4% PFA, and primary antibody NBP1-59254 was used at a concentration of 1ug/mL (along with Parvalbumin antibody for double staining) with gentle shaking and overnight incubation at 4C. For the detection of NBP1-59254 primary, anti-rabbit Alexa 555 secondary was employed and images were captured using a confocal microscope at 63X resolution.
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Sample Tissue: Human 293T Antibody Dilution: 1.0 ug/ml
Western Blot: Connexin 36/GJD2 Antibody [NBP1-59254] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:62500 Positive Control: Jurkat cell lysate GJD2 is supported by BioGPS gene expression data to be expressed in Jurkat
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
CRB3 Antibody
NBP1-81185
Immunocytochemistry/Immunofluorescence: CRB3 Antibody [NBP1-81185] - Staining of human cell line U-2 OS shows localization to cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: CRB3 Antibody [NBP1-81185] - Staining of human duodenum shows high expression.
(6 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
CRB2 Antibody
NBP1-91809
Immunohistochemistry-Paraffin: CRB2 Antibody [NBP1-91809] - Staining of human Cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: CRB2 Antibody [NBP1-91809] - Staining of human Eye, retina shows strong positivity in outer limiting membrane.
Immunohistochemistry-Paraffin: CRB2 Antibody [NBP1-91809] - Staining of human Fallopian tube shows weak positivity in apical membrane in glandular cells.
Species: Hu
Applications: IHC, IHC-P
Claudin-7 Antibody
(6-G3)
NBP2-66784
Immunocytochemistry/Immunofluorescence: Claudin-7 Antibody (6-G3) [NBP2-66784] - Staining CLDN7 in SW480 cells (red). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Western Blot: Claudin-7 Antibody (6-G3) [NBP2-66784] - Analysis on SW480 cell lysate using anti- CLDN7 mouse mAb.
Immunohistochemistry-Paraffin: Claudin-7 Antibody (6-G3) [NBP2-66784] - Immunohistochemical analysis of paraffin-embedded Human kidney using anti-Claudin-7 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1/100) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MUPP1 Antibody
NBP1-87839
MUPP1 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for MUPP1 Antibody (NBP1-87839) (0)

There are no publications for MUPP1 Antibody (NBP1-87839).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for MUPP1 Antibody (NBP1-87839) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Canine, Human, Mouse, Pig.

Reviews using NBP1-87839:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Canine, Human, Mouse, Pig
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot MUPP1 NBP1-87839
Enlarge 		4
reviewed by:
Pavel Nedvetsky
 Western Blot Canine, Human, Mouse, Pig 10/10/2017
View

Summary

ApplicationWestern Blot
Sample Tested293 cell extract,Caco-2 cell line,canine kidney tissue culture cells (= MDCK cells),EA.hy926 cell lysates,HUVEC,LLC-PK1 cells,porcine aortic endothelial cells
SpeciesCanine, Human, Mouse, Pig
LotA96400

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MUPP1 Antibody (NBP1-87839) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MUPP1 Products

Array NBP1-87839

Bioinformatics Tool for MUPP1 Antibody (NBP1-87839)

Discover related pathways, diseases and genes to MUPP1 Antibody (NBP1-87839). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MUPP1 Antibody (NBP1-87839)

Discover more about diseases related to MUPP1 Antibody (NBP1-87839).
 

Pathways for MUPP1 Antibody (NBP1-87839)

View related products by pathway.

PTMs for MUPP1 Antibody (NBP1-87839)

Learn more about PTMs related to MUPP1 Antibody (NBP1-87839).
 

Research Areas for MUPP1 Antibody (NBP1-87839)

Find related products by research area.

Blogs on MUPP1

There are no specific blogs for MUPP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0
Western Blot MUPP1 NBP1-87839
Enlarge
 Pavel Nedvetsky
10/10/2017
Application: Western Blot
Species: Canine, Human, Mouse, Pig
read this review

Bioinformatics

Gene Symbol MPDZ