PIGP Antibody


Western Blot: PIGP Antibody [NBP1-84294] - Analysis in control (vector only transfected HEK293T lysate) and PIGP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: PIGP Antibody [NBP1-84294] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: PIGP Antibody [NBP1-84294] - Staining of human stomach shows strong membranous positivity in parietal cells.
Western Blot: PIGP Antibody [NBP1-84294] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

PIGP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NMMSTSPLDSIHTITDNYAKNQQQKKYQEEAIPALRDISISEVNQMFFLAAKELYTK
Specificity of human PIGP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PIGP Protein (NBP1-84294PEP)
Read Publication using NBP1-84294.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for PIGP Antibody

  • class P
  • DCRCDown syndrome critical region protein C
  • Down syndrome critical region protein 5
  • DSRC
  • EC
  • phosphatidylinositol glycan anchor biosynthesis, class P
  • Phosphatidylinositol-glycan biosynthesis class P protein
  • phosphatidylinositol-n-acetylglucosaminyltranferase subunit
  • PIG-P


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, IHC
Species: Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PIGP Antibody (NBP1-84294)(1)

Reviews for PIGP Antibody (NBP1-84294) (0)

There are no reviews for PIGP Antibody (NBP1-84294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PIGP Antibody (NBP1-84294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional PIGP Products

Bioinformatics Tool for PIGP Antibody (NBP1-84294)

Discover related pathways, diseases and genes to PIGP Antibody (NBP1-84294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PIGP Antibody (NBP1-84294)

Discover more about diseases related to PIGP Antibody (NBP1-84294).

Pathways for PIGP Antibody (NBP1-84294)

View related products by pathway.

PTMs for PIGP Antibody (NBP1-84294)

Learn more about PTMs related to PIGP Antibody (NBP1-84294).

Blogs on PIGP

There are no specific blogs for PIGP, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our PIGP Antibody and receive a gift card or discount.


Gene Symbol PIGP