MiRP1 Antibody


Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining of human liver shows low expression as expected.
Immunohistochemistry: MiRP1 Antibody [NBP2-38146] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining in human stomach and liver tissues using anti-KCNE2 antibody. Corresponding KCNE2 RNA-seq data are presented for the same tissues.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

MiRP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE
Specificity of human MiRP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MiRP1 Protein (NBP2-38146PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MiRP1 Antibody

  • ATFB4
  • cardiac voltage-gated potassium channel accessory subunit 2
  • human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1
  • LQT5
  • LQT6
  • MGC138292
  • MinK-related peptide 1
  • minK-related peptide-1
  • MIRP1
  • Potassium channel subunit beta MiRP1
  • potassium channel subunit, MiRP1
  • potassium voltage-gated channel subfamily E member 2
  • potassium voltage-gated channel, Isk-related family, member 2
  • voltage-gated K+ channel subunit MIRP1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, RNAi
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MiRP1 Antibody (NBP2-38146) (0)

There are no publications for MiRP1 Antibody (NBP2-38146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP1 Antibody (NBP2-38146) (0)

There are no reviews for MiRP1 Antibody (NBP2-38146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MiRP1 Antibody (NBP2-38146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for MiRP1 Antibody (NBP2-38146)

Discover related pathways, diseases and genes to MiRP1 Antibody (NBP2-38146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP1 Antibody (NBP2-38146)

Discover more about diseases related to MiRP1 Antibody (NBP2-38146).

Pathways for MiRP1 Antibody (NBP2-38146)

View related products by pathway.

PTMs for MiRP1 Antibody (NBP2-38146)

Learn more about PTMs related to MiRP1 Antibody (NBP2-38146).

Blogs on MiRP1

There are no specific blogs for MiRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MiRP1 Antibody and receive a gift card or discount.


Gene Symbol KCNE2