MiRP1 Antibody

Images

 
Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining of human testis.
Immunohistochemistry: MiRP1 Antibody [NBP2-38146] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.
Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining in human stomach and liver tissues using anti-KCNE2 antibody. Corresponding KCNE2 RNA-seq data are presented for the ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining of human cerebral cortex, liver, stomach and testis using Anti-KCNE2 antibody NBP2-38146 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: MiRP1 Antibody [NBP2-38146] - Staining of human cerebral cortex.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MiRP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MiRP1 Protein (NBP2-38146PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MiRP1 Antibody

  • ATFB4
  • cardiac voltage-gated potassium channel accessory subunit 2
  • human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1
  • LQT5
  • LQT6
  • MGC138292
  • MinK-related peptide 1
  • minK-related peptide-1
  • MIRP1
  • Potassium channel subunit beta MiRP1
  • potassium channel subunit, MiRP1
  • potassium voltage-gated channel subfamily E member 2
  • potassium voltage-gated channel, Isk-related family, member 2
  • voltage-gated K+ channel subunit MIRP1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MiRP1 Antibody (NBP2-38146) (0)

There are no publications for MiRP1 Antibody (NBP2-38146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP1 Antibody (NBP2-38146) (0)

There are no reviews for MiRP1 Antibody (NBP2-38146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MiRP1 Antibody (NBP2-38146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MiRP1 Products

Research Areas for MiRP1 Antibody (NBP2-38146)

Find related products by research area.

Blogs on MiRP1

There are no specific blogs for MiRP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MiRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE2
Uniprot