MiRP1 Antibody

Images

 
Immunohistochemistry: MiRP1 Antibody [NBP2-38146] - Staining of human stomach shows strong cytoplasmic positivity in subset of glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MiRP1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KCNE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
MiRP1 Protein (NBP2-38146PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MiRP1 Antibody

  • ATFB4
  • cardiac voltage-gated potassium channel accessory subunit 2
  • human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1
  • LQT5
  • LQT6
  • MGC138292
  • MinK-related peptide 1
  • minK-related peptide-1
  • MIRP1
  • Potassium channel subunit beta MiRP1
  • potassium channel subunit, MiRP1
  • potassium voltage-gated channel subfamily E member 2
  • potassium voltage-gated channel, Isk-related family, member 2
  • voltage-gated K+ channel subunit MIRP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00003757-Q01
Species: Hu
H00003753-M01
Species: Hu
Applications: WB, ELISA, RNAi
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NLS7412
Species: Hu, Mu, Rt, Po, Bt, Bv, Eq, Mk, Pm
Applications: IHC, IHC-P
H00081033-P01
Species: Hu
NBP1-83238
Species: Hu
Applications: IHC, IHC-P
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85835
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-33863
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19315
Species: Hu
Applications: WB
NBP1-89691
Species: Hu
Applications: IHC, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, RNAi
NBP2-12895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-52497
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC
NBP1-81049
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MiRP1 Antibody (NBP2-38146) (0)

There are no publications for MiRP1 Antibody (NBP2-38146).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP1 Antibody (NBP2-38146) (0)

There are no reviews for MiRP1 Antibody (NBP2-38146). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for MiRP1 Antibody (NBP2-38146) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MiRP1 Products

Bioinformatics Tool for MiRP1 Antibody (NBP2-38146)

Discover related pathways, diseases and genes to MiRP1 Antibody (NBP2-38146). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP1 Antibody (NBP2-38146)

Discover more about diseases related to MiRP1 Antibody (NBP2-38146).
 

Pathways for MiRP1 Antibody (NBP2-38146)

View related products by pathway.

PTMs for MiRP1 Antibody (NBP2-38146)

Learn more about PTMs related to MiRP1 Antibody (NBP2-38146).

Blogs on MiRP1

There are no specific blogs for MiRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MiRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE2
Uniprot