Reactivity | HuSpecies Glossary |
Applications | IHC, IHC-P |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAE |
Specificity | Specificity of human MiRP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | KCNE2 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for MiRP1 Antibody (NBP2-38146)Discover more about diseases related to MiRP1 Antibody (NBP2-38146).
| Pathways for MiRP1 Antibody (NBP2-38146)View related products by pathway.
|
PTMs for MiRP1 Antibody (NBP2-38146)Learn more about PTMs related to MiRP1 Antibody (NBP2-38146).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.