Kir2.2 Antibody - BSA Free

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Adult Placenta. Antibody Dilution: 1.0ug/ml

Immunohistochemistry-Paraffin: Kir2.2 Antibody [NBP2-87693] - Rabbit Anti-KCNJ12 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Se

Western Blot: Kir2.2 Antibody [NBP2-87693] - WB Suggested Anti-KCNJ12 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: Human brain

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Pancreas. Antibody Dilution: 1.0ug/ml

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Brain. Antibody Dilution: 1.0ug/ml

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Heart. Antibody Dilution: 1.0ug/ml

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Lung. Antibody Dilution: 1.0ug/ml

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Liver. Antibody Dilution: 1.0ug/ml

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Muscle. Antibody Dilution: 1.0ug/ml

Western Blot: Kir2.2 Antibody [NBP2-87693] - Host: Rabbit. Target Name: KCNJ12. Sample Type: Human Fetal Stomach. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Kir2.2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Kir2.2 Antibody - BSA Free (NBP2-87693) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human Kir2.2. Peptide sequence: KDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQAR The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ12
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Kir2.2 Antibody - BSA Free

• ATP-sensitive inward rectifier potassium channel 12
• hIRK
• hIRK1
• hkir2.2x
• Inward rectifier K(+) channel Kir2.2
• Inward rectifier K(+) channel Kir2.2v
• inward rectifier K(+) channel Kir2.6
• IRK2
• IRK-2
• IRK2IRK-2
• KCNJ12
• kcnj12x
• KCNJN1
• KCNJN1FLJ14167
• Kir2.2
• Kir2.2v
• Potassium channel, inwardly rectifying subfamily J member 12
• potassium inwardly-rectifying channel, subfamily J, inhibitor 1
• potassium inwardly-rectifying channel, subfamily J, member 12

Background

FUNCTION: Probably participates in establishing action potential waveform and excitability of neuronal and muscle tissues. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by extracellular barium and cesium. Tissue specificity: Highest level in cerebellum. Moderately found in kidney, forebrain and skeletal muscle. Not detected in uterus, liver and pancreas. Subcellular location: Membrane, Multi-pass membrane protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ12