KCNJ10 Antibody - BSA Free

Analysis in human cerebral cortex and skeletal muscle tissues using NBP2-62724 antibody. Corresponding KCNJ10 RNA-seq data are presented for the same tissues.

Staining of human cerebral cortex shows moderate cytoplasmic positivity in glial cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human colon shows no positivity in glandular cells as expected.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNJ10 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNJ10 Antibody - BSA Free (NBP2-62724) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
• Predicted Species: Mouse (100%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNJ10
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  KCNJ10 Recombinant Protein Antigen (NBP2-62724PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Protein A purified

Alternate Names for KCNJ10 Antibody - BSA Free

• ATP-dependent inwardly rectifying potassium channel Kir4.1
• ATP-sensitive inward rectifier potassium channel 10
• BIRK-10
• glial ATP-dependent inwardly rectifying potassium channel KIR4.1
• Inward rectifier K(+) channel Kir1.2
• inward rectifier K+ channel KIR1.2
• KCNJ10
• KCNJ13-PEN
• KIR1.2
• KIR4.1
• Potassium channel, inwardly rectifying subfamily J member 10
• potassium inwardly-rectifying channel, subfamily J, member 10
• SESAME

Background

KCNJ10 encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNJ10