KCNJ10 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Predicted Species |
Mouse (100%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
KCNJ10 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for KCNJ10 Antibody - BSA Free
Background
KCNJ10 encodes a member of the inward rectifier-type potassium channel family, characterized by having a greater tendency to allow potassium to flow into, rather than out of, a cell. The encoded protein may form a heterodimer with another potassium channel protein and may be responsible for the potassium buffering action of glial cells in the brain. Mutations in this gene have been associated with seizure susceptibility of common idiopathic generalized epilepsy syndromes.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: Block, CyTOF-reported, Flow
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ELISA, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, MiAr, WB
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
Publications for KCNJ10 Antibody (NBP2-62724) (0)
There are no publications for KCNJ10 Antibody (NBP2-62724).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for KCNJ10 Antibody (NBP2-62724) (0)
There are no reviews for KCNJ10 Antibody (NBP2-62724).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for KCNJ10 Antibody (NBP2-62724) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional KCNJ10 Products
Research Areas for KCNJ10 Antibody (NBP2-62724)
Find related products by research area.
|
Blogs on KCNJ10