KCNE1 Antibody - BSA Free

Western Blot: KCNE1 Antibody [NBP3-03910] - Analysis of extracts of various cell lines, using KCNE1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KCNE1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit KCNE1 Antibody - BSA Free (NBP3-03910) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KCNE1 (NP_000210.2). MILSNTTAVTPFLTKLWQETVQQGGNMSGLARRSPRSSDGKLEALYVLMVLGFFGFFTLGIMLSYIRSKKLEHSNDPFNVYIESDAWQEKDKAYVQARVL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 14 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for KCNE1 Antibody - BSA Free

• Delayed rectifier potassium channel subunit IsK
• FLJ18426
• FLJ38123
• IKs producing slow voltage-gated potassium channel subunit beta Mink
• ISK
• Isk-related subfamily, member 1
• JLNS2FLJ94103
• LQT2/5
• MGC33114
• Minimal potassium channel
• MinK
• potassium voltage-gated channel, Isk-related family, member 1
• voltage gated potassiun channel accessory subunit

Background

minK belongs to the potassium channel KCNE family. Potassium ion channels are essential to many cellular functions and show a high degree of diversity, varying in their electrophysiologic and pharmacologic properties. minK encodes a transmembrane protein known to associate with the product of the KVLQT1 gene to form the delayed rectifier potassium channel. Mutation in this gene are associated with both Jervell and Lange-Nielsen and Romano-Ward forms of long-QT syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNE1