KAT4/TBP Associated Factor 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: KAT4/TBP Associated Factor 1 Antibody [NBP1-90036] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: KAT4/TBP Associated Factor 1 Antibody [NBP1-90036] - Staining of human rectum shows nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

KAT4/TBP Associated Factor 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDSDVGSGGIRPKQPRMLQENTRMDMENEESMMSYEGDGGEASHGLEDSNISYGSYEEPDPKSNTQDTSFSSIGGYEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAF1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KAT4/TBP Associated Factor 1 Protein (NBP1-90036PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for KAT4/TBP Associated Factor 1 Antibody

  • 250kDa
  • BA2Rdystonia 3 (with Parkinsonism)
  • CCG1TATA box binding protein (TBP)-associated factor, RNA polymerase II, A, 250kD
  • CCGS
  • Cell cycle gene 1 protein
  • cell cycle, G1 phase defect
  • complementation of cell cycle block, G1-to-S
  • DYT3/TAF1
  • EC 2.7.11
  • EC 2.7.11.1
  • KAT4
  • NSCL2
  • OF
  • P250
  • TAF(II)250
  • TAF1 RNA polymerase II, TATA box binding protein (TBP)-associated factor
  • TAF2AN-TAF1
  • TAFII-250
  • TAFII250DYT3
  • TBP-associated factor 250 kDa
  • transcription factor TFIID p250 polypeptide
  • Transcription initiation factor TFIID 250 kDa subunit
  • transcription initiation factor TFIID subunit 1
  • XDP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-38188
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1334
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-80705
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-01265
Species: Hu, Ca, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00006879-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB600-233
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA

Publications for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036) (0)

There are no publications for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036) (0)

There are no reviews for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional KAT4/TBP Associated Factor 1 Products

Bioinformatics Tool for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036)

Discover related pathways, diseases and genes to KAT4/TBP Associated Factor 1 Antibody (NBP1-90036). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036)

Discover more about diseases related to KAT4/TBP Associated Factor 1 Antibody (NBP1-90036).
 

Pathways for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036)

View related products by pathway.

PTMs for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036)

Learn more about PTMs related to KAT4/TBP Associated Factor 1 Antibody (NBP1-90036).
 

Research Areas for KAT4/TBP Associated Factor 1 Antibody (NBP1-90036)

Find related products by research area.

Blogs on KAT4/TBP Associated Factor 1

There are no specific blogs for KAT4/TBP Associated Factor 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our KAT4/TBP Associated Factor 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAF1