KAP1 Antibody - BSA Free

Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining in human ovary and liver tissues using anti-TRIM28 antibody. Corresponding TRIM28 RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: KAP1 Antibody [NBP2-39014] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining of human liver shows low expression as expected.

Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining of human ovary shows high expression.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

KAP1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
• Predicted Species: Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM28
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  KAP1 Protein (NBP2-39014PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for KAP1 Antibody - BSA Free

• E3 SUMO-protein ligase TRIM28
• EC 6.3.2.-
• FLJ29029
• KAP1
• KAP-1
• KAP1KRAB-associated protein 1
• KRIP-1
• Nuclear corepressor KAP-1
• RNF96
• RNF96KRAB-interacting protein 1
• TF1B
• TIF1B
• TIF1-beta
• TIF1BRING finger protein 96
• transcription intermediary factor 1-beta
• transcriptional intermediary factor 1-beta
• TRIM28
• tripartite motif containing 28
• tripartite motif-containing 28
• Tripartite motif-containing protein 28

Background

KAP1 is encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for KAP1 Antibody (NBP2-39014)(1)

Publication using NBP2-39014

• Markmiller S, Sathe S, Server KL et al. Persistent mRNA localization defects and cell death in ALS neurons caused by transient cellular stress Cell reports 2021-09-07 [PMID: 34496257]

Bioinformatics

• Gene Symbol: TRIM28
• Uniprot:
  • Q13263(Human)