KAP1 Antibody


Immunocytochemistry/ Immunofluorescence: KAP1 Antibody [NBP2-39014] - Immunofluorescent staining of human cell line A549 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining in human ovary and liver tissues using anti-TRIM28 antibody. Corresponding TRIM28 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: KAP1 Antibody [NBP2-39014] - Staining of human ovary shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

KAP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: TDSTFSLDQPGGTLDLTLIRARLQEKLSPPYSSPQEFAQDVGRMFKQFNKLTEDKADVQSIIGLQRFFETRMNEAFGDTKFSAVLV
Specificity of human KAP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
KAP1 Protein (NBP2-39014PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for KAP1 Antibody

  • E3 SUMO-protein ligase TRIM28
  • EC 6.3.2.-
  • FLJ29029
  • KAP1
  • KAP-1
  • KAP1KRAB-associated protein 1
  • KRIP-1
  • Nuclear corepressor KAP-1
  • RNF96
  • RNF96KRAB-interacting protein 1
  • TF1B
  • TIF1B
  • TIF1-beta
  • TIF1BRING finger protein 96
  • transcription intermediary factor 1-beta
  • transcriptional intermediary factor 1-beta
  • TRIM28
  • tripartite motif containing 28
  • tripartite motif-containing 28
  • Tripartite motif-containing protein 28


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu
Applications: WB, ICC/IF, Flow-IC
Species: Hu
Applications: ELISA, IHC
Species: Hu
Applications: WB, IP, ChIP, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC, ICC, KO
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for KAP1 Antibody (NBP2-39014) (0)

There are no publications for KAP1 Antibody (NBP2-39014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KAP1 Antibody (NBP2-39014) (0)

There are no reviews for KAP1 Antibody (NBP2-39014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for KAP1 Antibody (NBP2-39014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for KAP1 Antibody (NBP2-39014)

Discover related pathways, diseases and genes to KAP1 Antibody (NBP2-39014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for KAP1 Antibody (NBP2-39014)

Discover more about diseases related to KAP1 Antibody (NBP2-39014).

Pathways for KAP1 Antibody (NBP2-39014)

View related products by pathway.

PTMs for KAP1 Antibody (NBP2-39014)

Learn more about PTMs related to KAP1 Antibody (NBP2-39014).

Research Areas for KAP1 Antibody (NBP2-39014)

Find related products by research area.

Blogs on KAP1

There are no specific blogs for KAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our KAP1 Antibody and receive a gift card or discount.


Gene Symbol TRIM28