Kallikrein 3/PSA Antibody

Images

 
Immunohistochemistry-Paraffin: Kallikrein 3/PSA Antibody [NBP1-90120] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Kallikrein 3/PSA Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KLK3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Kallikrein 3/PSA Protein (NBP1-90120PEP)
Publications
Read Publications using
NBP1-90120 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 21091088)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Kallikrein 3/PSA Antibody

  • APS seminin
  • EC 3.4.21
  • EC 3.4.21.77
  • Gamma-seminoprotein
  • hK3
  • Kallikrein 3
  • kallikrein 3, (prostate specific antigen)
  • Kallikrein-3
  • kallikrein-related peptidase 3
  • KLK2A1
  • KLK3
  • P-30 antigen
  • prostate specific antigen
  • prostate-specific antigen
  • PSA semenogelase
  • PSA
  • Semenogelase
  • Seminin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB4104
Species: Hu
Applications: WB, IP, Neut
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57200
Species: Hu
Applications: ICC/IF
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90120
Species: Hu
Applications: IHC, IHC-P

Publications for Kallikrein 3/PSA Antibody (NBP1-90120)(3)

Reviews for Kallikrein 3/PSA Antibody (NBP1-90120) (0)

There are no reviews for Kallikrein 3/PSA Antibody (NBP1-90120). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Kallikrein 3/PSA Antibody (NBP1-90120) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Kallikrein 3/PSA Products

Bioinformatics Tool for Kallikrein 3/PSA Antibody (NBP1-90120)

Discover related pathways, diseases and genes to Kallikrein 3/PSA Antibody (NBP1-90120). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Kallikrein 3/PSA Antibody (NBP1-90120)

Discover more about diseases related to Kallikrein 3/PSA Antibody (NBP1-90120).
 

Pathways for Kallikrein 3/PSA Antibody (NBP1-90120)

View related products by pathway.

PTMs for Kallikrein 3/PSA Antibody (NBP1-90120)

Learn more about PTMs related to Kallikrein 3/PSA Antibody (NBP1-90120).
 

Research Areas for Kallikrein 3/PSA Antibody (NBP1-90120)

Find related products by research area.

Blogs on Kallikrein 3/PSA

There are no specific blogs for Kallikrein 3/PSA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Kallikrein 3/PSA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KLK3
Entrez