Jumonji/JARID2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Jumonji/JARID2 Antibody [NBP2-57019] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & mitochondria.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Jumonji/JARID2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
• Predicted Species: Mouse (96%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JARID2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Jumonji/JARID2 Recombinant Protein Antigen (NBP2-57019PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Jumonji/JARID2 Antibody - BSA Free

• JARID2
• JMJ
• JMJjumonji-like protein
• jumonji (mouse) homolog
• jumonji homolog
• Jumonji
• jumonji, AT rich interactive domain 2
• Jumonji/ARID domain-containing protein 2
• protein Jumonji

Background

Jumonji (JARID2) is a nuclear protein that participates in the negative regulation of cell growth. JARID2 is required for neural tube formation and is essential for normal heart development and function. In addition, Jumonji is a part of a group of proteins characterized by a novel structural motif, the JmjC domain, which is implicated in chromatin regulation through histone demethylation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JARID2