JMJD6/PSR Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: JMJD6/PSR Antibody [NBP2-57068] - Staining of human cell line PC-3 shows localization to nucleoplasm.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

JMJD6/PSR Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLA
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JMJD6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  JMJD6/PSR Recombinant Protein Antigen (NBP2-57068PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for JMJD6/PSR Antibody - BSA Free

• bifunctional arginine demethylase and lysyl-hydroxylase JMJD6
• EC 1.14.11
• EC 1.14.11.-
• Histone arginine demethylase JMJD6
• JmjC domain-containing protein 6
• JMJD6
• jumonji domain containing 6
• Jumonji domain-containing protein 6
• KIAA0585PSR
• Lysyl-hydroxylase JMJD6
• Peptide-lysine 5-dioxygenase JMJD6
• Phosphatidylserine receptorPTDSR
• Protein PTDSR
• PSR
• PTDSR
• PTDSR1

Background

JMJD6 encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells; however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JMJD6