JAKMIP1 Antibody

Western Blot: JAKMIP1 Antibody [NBP2-14137] - Analysis in control (vector only transfected HEK293T lysate) and JAKMIP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: JAKMIP1 Antibody [NBP2-14137] - Staining of human lymph node shows moderate cytoplasmic positivity in non-germinal center cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

JAKMIP1 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LVEKNKRMNKKNEDLLQSIQRMEEKIKNLTRENVEMKEKLSAQASLKRHTSLNDLSLTRDEQEIEFLRLQVLEQQHVIDDLSL
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: JAKMIP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  JAKMIP1 Protein (NBP2-14137PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for JAKMIP1 Antibody

• FLJ31564
• GABA-B receptor-binding protein
• Gababrbp
• JAMIP1Jak and microtubule interacting protein 1
• janus kinase and microtubule interacting protein 1
• marlin-1
• MARLIN1janus kinase and microtubule-interacting protein 1
• Multiple alpha-helices and RNA-linker protein 1
• multiple coiled-coil GABABR1-binding protein

Background

Associates with microtubules and may play a role in the microtubule-dependent transport of the GABA-Breceptor. May play a role in JAK1 signaling and regulate microtubule cytoskeleton rearrangements

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: JAKMIP1