Jak2 Antibody (4B0K1)

Immunoprecipitation: Jak2 Antibody (4B0K1) [NBP3-15825] - Immunoprecipitation analysis of 300ug extracts of K-562 cells using 3ug Jak2 antibody (NBP3-15825). Western blot was performed from the immunoprecipitate using Jak2 antibody (NBP3-15825) at a dilition of 1:1000.

• Reactivity: Hu, Mu
• Applications: WB
• Clone: 4B0K1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Jak2 Antibody (4B0K1) Summary

• Description: Novus Biologicals Rabbit Jak2 Antibody (4B0K1) (NBP3-15825) is a recombinant monoclonal antibody validated for use in WB. Anti-Jak2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1033-1132 of human Jak2 (O60674). VASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: JAK2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Jak2 Antibody (4B0K1)

• EC 2.7.10
• EC 2.7.10.2
• Jak2
• JAK-2
• Janus kinase 2Janus kinase 2 (a protein tyrosine kinase)
• JTK10
• tyrosine-protein kinase JAK2

Background

Jak2 is a member of the Janus family tyrosine kinases (Jaks), whose function is to transduce extracellular signals from cytokines and interferons. Jaks associate with cytokine receptors; upon ligand binding, Jaks phosphorylate the receptor. The phosphorylated receptors are bound by SH2-containing proteins, one class of which is the signal transducers and activators of transcription (STATs). Activated STATs, then, translocate to the nucleus to mediate gene transcription (1,2). Tyr1007/1008 of Jak2 are the homologous Tyr1054/1055 in Tyk2, and phosphorylation at these residues is needed for Tyk2 activation (3). A chromosomal aberration involving Jak2 is found in a form of pre-B acute myeloid leukemia (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Jak2 Antibody (NBP3-15825)(1)

Publication using NBP3-15825

• Long Y, Wang Y, Shen Y et al. Minocycline and antipsychotics inhibit inflammatory responses in BV-2 microglia activated by LPS via regulating the MAPKs/ JAK-STAT signaling pathway BMC psychiatry 2023-07-18 [PMID: 37464316] (WB)

Bioinformatics

• Gene Symbol: JAK2