ITPK1 Antibody - BSA Free

Western Blot: ITPK1 Antibody [NBP1-56619] - Human Heart lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ITPK1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ITPK1(inositol 1,3,4-triphosphate 5/6 kinase) The peptide sequence was selected from the N terminal of ITPK1. Peptide sequence MEVVQLNLSRPIEEQGPLDVIIHKLTDVILEADQNDSQSLELVHRFQEYI. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITPK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ITPK1 Antibody - BSA Free

• EC 2.7.1.134
• EC 2.7.1.159
• inositol 13,4-triphosphate 5/6 kinase
• inositol 13,4-trisphosphate 5/6 kinase
• Inositol 13,4-trisphosphate 5/6-kinase
• inositol-tetrakisphosphate 1-kinase
• Inositol-triphosphate 5/6-kinase
• Ins(13,4)P(3) 5/6-kinase
• ITRPK1

Background

ITPK1 is the kinase that can phosphorylate various inositol polyphosphate such as Ins(3,4,5,6)P4 or Ins(1,3,4)P3. It may also act as an isomerase that interconverts the inositol tetraphosphate isomers Ins(1,3,4,5)P4 and Ins(1,3,4,6)P4 in the presence of ADP and magnesium. It probably acts as the rate-limiting enzyme of the InsP6 pathway. ITPK1 modifies TNF-alpha-induced apoptosis by interfering with the activation of TNFRSF1A-associated death domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITPK1
• Uniprot:
  • Q13572(Human)