IPPK Antibody - BSA Free

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human liver very weak cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: IPPK Antibody [NBP1-86712] - Staining of human pancreas shows no positivity in exocrine or endocrine glandular cells as expected.

Analysis in human cell line BEWO.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IPPK Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit IPPK Antibody - BSA Free (NBP1-86712) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GCLLYKTLQVQMLDLLDIEGLYPLYNRVERYLEEFPEERKTLQIDGPYDEAFYQKLLDLSTEDDGTVAFALTKVQQYR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IPPK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IPPK Protein (NBP1-86712PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IPPK Antibody - BSA Free

• bA476B13.1 (novel protein)
• bA476B13.1
• C9orf12
• chromosome 9 open reading frame 12
• EC 2.7.1.158
• FLJ13163
• inositol 13,45,6-pentakisphosphate 2-kinase
• Inositol-13,45,6-pentakisphosphate 2-kinase
• inositol-pentakisphosphate 2-kinase
• Ins(13,45,6)P5 2-kinase
• InsP5 2-kinase
• INSP5K2
• IP5K
• IPK1 homolog
• IPK1
• KIAA0699

Background

Phosphorylates Ins(1,3,4,5,6)P5 at position 2 to form Ins(1,2,3,4,5,6)P6 (InsP6 or phytate). InsP6 isinvolved in many processes such as mRNA export, non-homologous end-joining, endocytosis, ion channel regulation. Italso protects cells from TNF-alpha-induced apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IPPK