ITIH5 Antibody

Images

 
Western Blot: ITIH5 Antibody [NBP3-09494] - Western blot analysis of ITIH5 in HepG2 Whole Cell as a positive control. Antibody dilution at 1.0 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITIH5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ITIH5 (NP_001001851). Peptide sequence ASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKR
Clonality
Polyclonal
Host
Rabbit
Gene
ITIH5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
75 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for ITIH5 Antibody

  • inter-alpha (globulin) inhibitor H5
  • inter-alpha-inhibitor heavy chain 5
  • inter-alpha-trypsin inhibitor heavy chain H5
  • ITI heavy chain H5
  • ITIH5 inter-alpha-trypsin inhibitor heavy chain family, member 5
  • ITIH5
  • ITI-HC5
  • KIAA1953
  • MGC10848
  • PP14776

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76910
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-93612
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-81782
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF482
Species: Mu
Applications: IHC, WB
AF2330
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
NBP1-89680
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-66995
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-55415
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-43853
Species: Bv, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB400-104
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
NBP2-31750
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-48336
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP3-16249
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-47704
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-09494
Species: Hu
Applications: WB

Publications for ITIH5 Antibody (NBP3-09494) (0)

There are no publications for ITIH5 Antibody (NBP3-09494).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITIH5 Antibody (NBP3-09494) (0)

There are no reviews for ITIH5 Antibody (NBP3-09494). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ITIH5 Antibody (NBP3-09494) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITIH5 Products

Bioinformatics Tool for ITIH5 Antibody (NBP3-09494)

Discover related pathways, diseases and genes to ITIH5 Antibody (NBP3-09494). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH5 Antibody (NBP3-09494)

Discover more about diseases related to ITIH5 Antibody (NBP3-09494).
 

Pathways for ITIH5 Antibody (NBP3-09494)

View related products by pathway.

PTMs for ITIH5 Antibody (NBP3-09494)

Learn more about PTMs related to ITIH5 Antibody (NBP3-09494).

Blogs on ITIH5

There are no specific blogs for ITIH5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITIH5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITIH5