ITIH2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ITIH2 Antibody [NBP2-31750] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human testis shows distinct positivity in plasma.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITIH2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITIH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ITIH2 Protein (NBP2-31750PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITIH2 Antibody

  • H2P
  • IGHEP2
  • inter-alpha (globulin) inhibitor H2
  • inter-alpha (globulin) inhibitor, H2 polypeptide
  • Inter-alpha-inhibitor heavy chain 2
  • Inter-alpha-trypsin inhibitor complex component II
  • inter-alpha-trypsin inhibitor heavy chain H2
  • ITI heavy chain H2
  • ITI-HC2
  • Serum-derived hyaluronan-associated protein
  • SHAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-81782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1265
Species: Mu
Applications: WB, IP, Neut
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB500-470
Species: Hu
Applications: ELISA, Flow
MAB4368
Species: Hu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93705
Species: Hu
Applications: IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP2-31750
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for ITIH2 Antibody (NBP2-31750) (0)

There are no publications for ITIH2 Antibody (NBP2-31750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITIH2 Antibody (NBP2-31750) (0)

There are no reviews for ITIH2 Antibody (NBP2-31750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ITIH2 Antibody (NBP2-31750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITIH2 Products

Bioinformatics Tool for ITIH2 Antibody (NBP2-31750)

Discover related pathways, diseases and genes to ITIH2 Antibody (NBP2-31750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH2 Antibody (NBP2-31750)

Discover more about diseases related to ITIH2 Antibody (NBP2-31750).
 

Pathways for ITIH2 Antibody (NBP2-31750)

View related products by pathway.

Blogs on ITIH2

There are no specific blogs for ITIH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITIH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITIH2
Uniprot