ITIH2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ITIH2 Antibody [NBP2-31750] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.

Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.

Immunocytochemistry/Immunofluorescence: ITIH2 Antibody [NBP2-31750] - HC-HA formation after LPS or PA injury. Immunofluorescence images of HA and HC localization in formalin-fixed, paraffin-embedded lung sections from control (0 dpi) and PA-injured (1 and 2 dpi) mice, using antibodies against HA binding protein (red) or HC2 (green), and staining for nuclei with DAPI (Blue). Staining control provided in the last row, using secondary antibody only. Note HC-HA co-localization in the peri-broncho (Br)-vascular (V) interstitium (white arrow); scale bar 50 um. Image collected and cropped by CiteAb from the following publication (//respiratory-research.biomedcentral.com/articles/10.1186/s12931-018-0812-1), licensed under a CC-BY license.

Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human duodenum shows moderate positivity in plasma in blood vessels.

Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human fallopian tube shows strong positivity in plasma in blood vessels.

Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human endometrium shows no positivity in glandular cells as expected.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ITIH2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITIH2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen Reported in scientific literature (PMID: 29855321)
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot Reported in scientific literature (PMID: 30623115).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ITIH2 Recombinant Protein Antigen (NBP2-31750PEP)

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 29855321).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITIH2 Antibody - BSA Free

• H2P
• IGHEP2
• Inter-Alpha (Globulin) Inhibitor H2
• inter-alpha (globulin) inhibitor, H2 polypeptide
• Inter-alpha-inhibitor heavy chain 2
• Inter-alpha-trypsin inhibitor complex component II
• inter-alpha-trypsin inhibitor heavy chain H2
• Intin2
• ITI Heavy Chain H2
• ITIH2
• ITI-H2
• ITI-HC2
• Serum-derived hyaluronan-associated protein
• SHAP

Background

The inter-alpha-trypsin inhibitors (ITI) are a family of structurally related plasma serine protease inhibitors involved in extracellular matrix stabilization and in prevention of tumor metastasis. The ITI family contains multiple proteins made up of a light chain (see MIM 176870) and a variable number of heavy chains (Salier et al., 1987 (PubMed 2446322); Himmelfarb et al., 2004 (PubMed 14744536)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ITIH2 Antibody (NBP2-31750)(3)

Publications using NBP2-31750

• Bota-Rabassedas N, Banerjee P, Niu Y et al. Contextual cues from cancer cells govern cancer-associated fibroblast heterogeneity Cell reports 2021-04-20 [PMID: 33882319] (WB, Mouse)
• Igari K, Kelly MJ, Yamanouchi D Intravascular heavy chain-modification of hyaluronan during endotoxic shock Biochem Biophys Rep Mar 1 2019 [PMID: 30623115] (WB)
• Ni K, Gill A, Tseng V et al. Rapid clearance of heavy chain-modified hyaluronan during resolving acute lung injury Respir. Res. 2018-05-31 [PMID: 29855321] (IHC-Fr, Mouse)

Bioinformatics

• Gene Symbol: ITIH2
• Uniprot:
  • P19823(Human)