ITIH2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ITIH2 Antibody [NBP2-31750] - Staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.
Immunocytochemistry/ Immunofluorescence: ITIH2 Antibody [NBP2-31750] - HC-HA formation after LPS or PA injury. Immunofluorescence images of HA and HC localization in formalin-fixed, paraffin-embedded lung sections from ...read more
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human duodenum shows moderate positivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human fallopian tube shows strong positivity in plasma in blood vessels.
Immunohistochemistry-Paraffin: ITIH2 Antibody [NBP2-31750] - Staining of human endometrium shows no positivity in glandular cells as expected.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITIH2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LPGAKVQFELHYQEVKWRKLGSYEHRIYLQPGRLAKHLEVDVWVIEPQGLRFLHVPDTFEGHFDGVPVISKGQQKAHVSFKPTVAQQRICPNCRET
Specificity
Specificity of human ITIH2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITIH2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Western blot reported in scientific literature (PMID: 30623115). Use in IHC-FR reported in scientific literature (PMID: 29855321).
Control Peptide
ITIH2 Recombinant Protein Antigen (NBP2-31750PEP)
Publications
Read Publications using
NBP2-31750 in the following applications:

Reactivity Notes

Mouse reactivity reported in the scientific literature (PMID: 29855321).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITIH2 Antibody

  • H2P
  • IGHEP2
  • Inter-Alpha (Globulin) Inhibitor H2
  • inter-alpha (globulin) inhibitor, H2 polypeptide
  • Inter-alpha-inhibitor heavy chain 2
  • Inter-alpha-trypsin inhibitor complex component II
  • inter-alpha-trypsin inhibitor heavy chain H2
  • Intin2
  • ITI Heavy Chain H2
  • ITIH2
  • ITI-H2
  • ITI-HC2
  • Serum-derived hyaluronan-associated protein
  • SHAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76910
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2104
Species: Hu, Mu
Applications: WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF1265
Species: Mu
Applications: WB, IP, Neut
NBP2-39087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75633
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-25160
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq
Applications: WB, ICC/IF, IHC
NB7343
Species: Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-82145
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04982
Species: Hu, Mu, Rt
Applications: WB
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP

Publications for ITIH2 Antibody (NBP2-31750)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: IHC-Fr, WB.


Filter By Application
IHC-Fr
(1)
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for ITIH2 Antibody (NBP2-31750) (0)

There are no reviews for ITIH2 Antibody (NBP2-31750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ITIH2 Antibody (NBP2-31750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ITIH2 Products

Bioinformatics Tool for ITIH2 Antibody (NBP2-31750)

Discover related pathways, diseases and genes to ITIH2 Antibody (NBP2-31750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH2 Antibody (NBP2-31750)

Discover more about diseases related to ITIH2 Antibody (NBP2-31750).
 

Pathways for ITIH2 Antibody (NBP2-31750)

View related products by pathway.

Blogs on ITIH2

There are no specific blogs for ITIH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITIH2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITIH2
Uniprot