WISP2 Antibody - BSA Free

Images

 
Western Blot: WISP2 Antibody [NBP2-93612] - Analysis of extracts of Mouse ovary, using WISP2 antibody (NBP2-93612) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more
Immunohistochemistry-Paraffin: WISP2 Antibody [NBP2-93612] - Rat testis using WISP2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC ...read more
Immunohistochemistry-Paraffin: WISP2 Antibody [NBP2-93612] - Human colon using WISP2 Rabbit pAb at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC ...read more
ICC/IF-WISP2 Antibody [NBP2-93612] - HeLa cells using WISP2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
ICC/IF-WISP2 Antibody [NBP2-93612] - MCF7 cells using WISP2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

WISP2 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 164-250 of human WISP2 (NP_003872.1). GQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCN5
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:100 - 1:500
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for WISP2 Antibody - BSA Free

  • CCN5
  • Connective tissue growth factor-like protein
  • Connective tissue growth factor-related protein 58
  • CT58CTGF-Lwnt-1 signaling pathway protein 2
  • CTGFL
  • CTGF-L
  • WISP2
  • WISP-2
  • WNT1 inducible signaling pathway protein 2
  • WNT1-inducible-signaling pathway protein 2

Background

WISP2 encodes a member of the WNT1 inducible signaling pathway (WISP) protein subfamily, which belongs to the connective tissue growth factor (CTGF) family. WNT1 is a member of a family of cysteine-rich, glycosylated signaling proteins that mediate diverse developmental processes. The CTGF family members are characterized by four conserved cysteine-rich domains: insulin-like growth factor-binding domain, von Willebrand factor type C module, thrombospondin domain and C-terminal cystine knot-like (CT) domain. The encoded protein lacks the CT domain which is implicated in dimerization and heparin binding. It is 72% identical to the mouse protein at the amino acid level. This gene may be downstream in the WNT1 signaling pathway that is relevant to malignant transformation. Its expression in colon tumors is reduced while the other two WISP members are overexpressed in colon tumors. It is expressed at high levels in bone tissue, and may play an important role in modulating bone turnover.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93872
Species: Hu, Mu, Rt
Applications: ELISA, WB
MAB2839
Species: Hu, Mu, Rt
Applications: WB
NBP1-31330
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-02609
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for WISP2 Antibody (NBP2-93612) (0)

There are no publications for WISP2 Antibody (NBP2-93612).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WISP2 Antibody (NBP2-93612) (0)

There are no reviews for WISP2 Antibody (NBP2-93612). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WISP2 Antibody (NBP2-93612) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WISP2 Products

Research Areas for WISP2 Antibody (NBP2-93612)

Find related products by research area.

Blogs on WISP2

There are no specific blogs for WISP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WISP2 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol CCN5