ITIH1 Antibody - BSA Free

Western Blot: ITIH1 Antibody [NBP1-81782] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)

Immunocytochemistry/Immunofluorescence: ITIH1 Antibody [NBP1-81782] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human placenta shows strong plasma positivity.

Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human colon shows strong plasma positivity.

Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human testis shows strong plasma positivity.

Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human endometrium shows strong plasma positivity.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ITIH1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITIH1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ITIH1 Protein (NBP1-81782PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ITIH1 Antibody - BSA Free

• H1P
• IATIH
• IGHEP1
• inter-alpha (globulin) inhibitor H1
• inter-alpha (globulin) inhibitor, H1 polypeptide
• Inter-alpha-inhibitor heavy chain 1
• Inter-alpha-trypsin inhibitor complex component III
• inter-alpha-trypsin inhibitor heavy chain H1
• ITI heavy chain H1
• ITIH
• ITIH1
• ITI-HC1
• MGC126415
• Serum-derived hyaluronan-associated protein
• SHAP

Background

The protein encoded by the ITIH1 gene is the heavy chain of a serine protease inhibitor that may serve to carry hyaluronanin plasma. This gene is part of a cluster of similar genes on chromosome 3. Multiple transcript variants encodingdifferent isoforms have been found for this gene. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITIH1