ITIH1 Antibody

Images

 
Western Blot: ITIH1 Antibody [NBP1-81782] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: ITIH1 Antibody [NBP1-81782] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human placenta shows strong plasma positivity.
Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human colon shows strong plasma positivity.
Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human testis shows strong plasma positivity.
Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human endometrium shows strong plasma positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITIH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITIH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ITIH1 Protein (NBP1-81782PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITIH1 Antibody

  • H1P
  • IATIH
  • IGHEP1
  • inter-alpha (globulin) inhibitor H1
  • inter-alpha (globulin) inhibitor, H1 polypeptide
  • Inter-alpha-inhibitor heavy chain 1
  • Inter-alpha-trypsin inhibitor complex component III
  • inter-alpha-trypsin inhibitor heavy chain H1
  • ITI heavy chain H1
  • ITIH
  • ITIH1
  • ITI-HC1
  • MGC126415
  • Serum-derived hyaluronan-associated protein
  • SHAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76910
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-34492
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP1-93705
Species: Hu
Applications: IHC, IHC-P
NBP2-31750
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
2326-TS
Species: Mu
Applications: Bind
NBP2-67702
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
AF1265
Species: Mu
Applications: IP, Neut, WB
NB500-470
Species: Hu
Applications: ELISA, Flow
DKK300
Species: Hu
Applications: ELISA
NBP2-39087
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-75633
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP3-09494
Species: Hu
Applications: WB
DMP900
Species: Hu
Applications: ELISA
NBP1-89993
Species: Hu
Applications: IHC, IHC-P, WB
AF2765
Species: Mu
Applications: IP, Neut, WB
NBP1-81782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ITIH1 Antibody (NBP1-81782) (0)

There are no publications for ITIH1 Antibody (NBP1-81782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITIH1 Antibody (NBP1-81782) (0)

There are no reviews for ITIH1 Antibody (NBP1-81782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ITIH1 Antibody (NBP1-81782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITIH1 Products

Bioinformatics Tool for ITIH1 Antibody (NBP1-81782)

Discover related pathways, diseases and genes to ITIH1 Antibody (NBP1-81782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH1 Antibody (NBP1-81782)

Discover more about diseases related to ITIH1 Antibody (NBP1-81782).
 

Pathways for ITIH1 Antibody (NBP1-81782)

View related products by pathway.

Blogs on ITIH1

There are no specific blogs for ITIH1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITIH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITIH1