ITIH1 Antibody

Images

 
Western Blot: ITIH1 Antibody [NBP1-81782] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunocytochemistry/ Immunofluorescence: ITIH1 Antibody [NBP1-81782] - Staining of human cell line U-2 OS shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ITIH1 Antibody [NBP1-81782] - Staining of human colon shows distinct positivity in extracellular material.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITIH1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PLTSMSIRGMADQDGLKPTIDKPSEDSPPLEMLGPRRTFVLSALQPSPTHSSSNTQRLPDRVTGVDTDPHFIIHVPQK
Specificity
Specificity of human ITIH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITIH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ITIH1 Protein (NBP1-81782PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITIH1 Antibody

  • H1P
  • IATIH
  • IGHEP1
  • inter-alpha (globulin) inhibitor H1
  • inter-alpha (globulin) inhibitor, H1 polypeptide
  • Inter-alpha-inhibitor heavy chain 1
  • Inter-alpha-trypsin inhibitor complex component III
  • inter-alpha-trypsin inhibitor heavy chain H1
  • ITI heavy chain H1
  • ITIH
  • ITI-HC1
  • MGC126415
  • Serum-derived hyaluronan-associated protein
  • SHAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00000259-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-81777
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-93705
Species: Hu
Applications: IHC, IHC-P
NBP2-31750
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB2104
Species: Hu, Mu
Applications: WB
NBP2-25162
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
AF1265
Species: Mu
Applications: WB, IP, Neut
DDXCH07P-100
Species: Hu
Applications: Flow, IHC-Fr, IHC-P, Flow-CS, Flow-IC, IF
NBP1-51635
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-37602
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ITIH1 Antibody (NBP1-81782) (0)

There are no publications for ITIH1 Antibody (NBP1-81782).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITIH1 Antibody (NBP1-81782) (0)

There are no reviews for ITIH1 Antibody (NBP1-81782). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ITIH1 Antibody (NBP1-81782) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ITIH1 Antibody (NBP1-81782)

Discover related pathways, diseases and genes to ITIH1 Antibody (NBP1-81782). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH1 Antibody (NBP1-81782)

Discover more about diseases related to ITIH1 Antibody (NBP1-81782).
 

Pathways for ITIH1 Antibody (NBP1-81782)

View related products by pathway.

Blogs on ITIH1

There are no specific blogs for ITIH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITIH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITIH1