ITIH3 Antibody

Images

 
Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ITIH3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQ
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITIH3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ITIH3 Protein (NBP1-93705PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ITIH3 Antibody

  • H3 polypeptide
  • H3P
  • inter-alpha (globulin) inhibitor H3
  • inter-alpha (globulin) inhibitor, H3 polypeptide
  • inter-alpha-inhibitor heavy chain 3
  • inter-alpha-trypsin inhibitor heavy chain H3
  • ITI heavy chain H3
  • ITIH3
  • ITI-HC3
  • serum-derived hyaluronan-associated protein
  • SHAP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-76910
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-81782
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-34492
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
AF1265
Species: Mu
Applications: IP, Neut, WB
NBP1-51635
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-75633
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66881
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
DMP900
Species: Hu
Applications: ELISA
H00152503-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF2498
Species: Mu
Applications: IP, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB300-917
Species: Hu, Mu
Applications: IF, IHC, IHC-P
1090-TW/CF
Species: Hu
Applications: BA
NBP3-13225
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB2104
Species: Hu, Mu
Applications: WB
AF1107
Species: Mu
Applications: IHC, WB
NBP1-84896
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for ITIH3 Antibody (NBP1-93705) (0)

There are no publications for ITIH3 Antibody (NBP1-93705).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ITIH3 Antibody (NBP1-93705) (0)

There are no reviews for ITIH3 Antibody (NBP1-93705). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ITIH3 Antibody (NBP1-93705) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ITIH3 Products

Bioinformatics Tool for ITIH3 Antibody (NBP1-93705)

Discover related pathways, diseases and genes to ITIH3 Antibody (NBP1-93705). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ITIH3 Antibody (NBP1-93705)

Discover more about diseases related to ITIH3 Antibody (NBP1-93705).
 

Pathways for ITIH3 Antibody (NBP1-93705)

View related products by pathway.

Blogs on ITIH3

There are no specific blogs for ITIH3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ITIH3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITIH3