![Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Placenta shows moderate cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/ITIH3-Antibody-Immunohistochemistry-Paraffin-NBP1-93705-img0005.jpg "Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Placenta shows moderate cytoplasmic positivity in trophoblastic cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ITIH3 Antibody - BSA Free (NBP1-93705) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ITIH3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Serpin D1/Heparin Cofactor II Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Serpin D1/Heparin Cofactor II Antibody [Unconjugated]")
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ITIH3 |
![Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ITIH3-Antibody-Immunohistochemistry-Paraffin-NBP1-93705-img0002.jpg "Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ITIH3-Antibody-Immunohistochemistry-Paraffin-NBP1-93705-img0003.jpg "Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Fallopian tube shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ITIH3-Antibody-Immunohistochemistry-Paraffin-NBP1-93705-img0004.jpg "Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ITIH3-Antibody-Immunohistochemistry-Paraffin-NBP1-93705-img0006.jpg "Immunohistochemistry-Paraffin: ITIH3 Antibody [NBP1-93705] - Staining of human Testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/DATA_TIMP1_DTM100_ELISA_847.jpg)
![N/A TIMP-1 [HRP]](https://images.novusbio.com/images2/TIMP-1_DTM100_ELISA_194.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/Haptoglobin_DHAPG0_ELISA_461.jpg)
![N/A Haptoglobin [HRP]](https://images.novusbio.com/images2/DATA_Haptoglobin_DHAPG0_ELISA_709.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/MMP-9_DMP900_ELISA_148.jpg)
![N/A MMP-9 [HRP]](https://images.novusbio.com/images2/DATA_MMP9_DMP900_ELISA_770.jpg)
![SDS-PAGE TWEAK/TNFSF12 [Unconjugated]](https://images.novusbio.com/images2/TWEAK_1090-TW_CF_655.jpg)
![Bioactivity TWEAK/TNFSF12 [Unconjugated]](https://images.novusbio.com/images2/TWEAK_1090-TW_CF_657.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")