PHC3 Antibody

Images

 
Western Blot: PHC3 Antibody [NBP1-84896] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: PHC3 Antibody [NBP1-84896] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules and moderate nuclear staining in cells in glomeruli.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PHC3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPSKVSHHQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PHC3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PHC3 Protein (NBP1-84896PEP)
Publications
Read Publication using
NBP1-84896 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23301003).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PHC3 Antibody

  • DKFZp313K1221
  • early development regulator 3
  • Early development regulatory protein 3
  • EDR3FLJ12729
  • FLJ12967
  • Homolog of polyhomeotic 3
  • HPH3
  • MGC88144
  • PH3
  • polyhomeotic homolog 3 (Drosophila)
  • polyhomeotic like 3 (Drosophila)
  • polyhomeotic like 3
  • polyhomeotic-like protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91979
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37371
Species: Hu
Applications: WB, ELISA, Flow, CyTOF-ready
NBP2-03348
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-52084
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
NBP1-89200
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF2009
Species: Hu
Applications: WB, IHC
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32390
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF2419
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-84896
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PHC3 Antibody (NBP1-84896)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for PHC3 Antibody (NBP1-84896) (0)

There are no reviews for PHC3 Antibody (NBP1-84896). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PHC3 Antibody (NBP1-84896) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PHC3 Products

Bioinformatics Tool for PHC3 Antibody (NBP1-84896)

Discover related pathways, diseases and genes to PHC3 Antibody (NBP1-84896). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PHC3 Antibody (NBP1-84896)

Discover more about diseases related to PHC3 Antibody (NBP1-84896).
 

Pathways for PHC3 Antibody (NBP1-84896)

View related products by pathway.

Blogs on PHC3

There are no specific blogs for PHC3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PHC3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PHC3