PHC3 Antibody - BSA Free

Western Blot: PHC3 Antibody [NBP1-84896] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue

Immunohistochemistry-Paraffin: PHC3 Antibody [NBP1-84896] - Staining of human lymph node shows strong nuclear positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: PHC3 Antibody [NBP1-84896] - Staining of human testis shows strong nuclear positivity in seminiferous ducts.

Immunohistochemistry-Paraffin: PHC3 Antibody [NBP1-84896] - Staining of human tonsil shows strong nuclear positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: PHC3 Antibody [NBP1-84896] - Staining of human prostate shows strong nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

PHC3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GVLSSSQNGPPKSTSQTQSLTICHNKTTVTSSKISQRDPSPESNKKGESPSLESRSTAVTRTSSIHQLIAPASYSPIQPHSLIKHQQIPLHSPPSKVSHHQ
• Predicted Species: Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: PHC3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence Reported in scientific literature (PMID: 23301003)
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended..
• Control Peptide:

  PHC3 Protein (NBP1-84896PEP)

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23301003).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for PHC3 Antibody - BSA Free

• DKFZp313K1221
• early development regulator 3
• Early development regulatory protein 3
• EDR3FLJ12729
• FLJ12967
• Homolog of polyhomeotic 3
• HPH3
• MGC88144
• PH3
• polyhomeotic homolog 3 (Drosophila)
• polyhomeotic like 3 (Drosophila)
• polyhomeotic like 3
• polyhomeotic-like protein 3

Background

Polyhomeotic-like 3 (PHC3) is a member of the polycomb family and part of the human polycomb complex, hPRC-H, a complex that represses HOX gene expression throughout development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PHC3 Antibody (NBP1-84896)(1)

Publication using NBP1-84896

• Choi Y, Kim HS, Cho KW et al. Noninvasive identification of viable cell populations in docetaxel-treated breast tumors using ferritin-based magnetic resonance imaging PLoS One 2013-01-01 [PMID: 23301003] (ICC/IF, IF/IHC, Mouse)

Bioinformatics

• Gene Symbol: PHC3