ISYNA1 Antibody

Images

 
Western Blot: ISYNA1 Antibody [NBP2-48513] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-48513] - Staining in human testis and liver tissues using anti-ISYNA1 antibody. Corresponding ISYNA1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-48513] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: ISYNA1 Antibody [NBP2-48513] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ISYNA1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: VYIPEFIAANQSARADNLIPGSRAQQLEQIRRDIRDFRSSAGLDKVIVLWTANTERFCEVIPGLNDTAENLLRTIELGLEVSPSTLFAVASILEGCAFLNGSPQNTLVP
Specificity
Specificity of human ISYNA1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ISYNA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ISYNA1 Recombinant Protein Antigen (NBP2-48513PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ISYNA1 Antibody

  • EC 5.5.1.4
  • hINO1
  • hIPS
  • INO1
  • INOS
  • inositol-3-phosphate synthase 1
  • IPSIPS 1
  • MI-1-P synthase
  • MIP synthase
  • Myo-inositol 1-phosphate synthase A1
  • Myo-inositol-1-phosphate synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-76919
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-48513
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for ISYNA1 Antibody (NBP2-48513) (0)

There are no publications for ISYNA1 Antibody (NBP2-48513).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISYNA1 Antibody (NBP2-48513) (0)

There are no reviews for ISYNA1 Antibody (NBP2-48513). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ISYNA1 Antibody (NBP2-48513) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ISYNA1 Antibody (NBP2-48513)

Discover related pathways, diseases and genes to ISYNA1 Antibody (NBP2-48513). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ISYNA1 Antibody (NBP2-48513)

Discover more about diseases related to ISYNA1 Antibody (NBP2-48513).
 

Pathways for ISYNA1 Antibody (NBP2-48513)

View related products by pathway.

PTMs for ISYNA1 Antibody (NBP2-48513)

Learn more about PTMs related to ISYNA1 Antibody (NBP2-48513).
 

Research Areas for ISYNA1 Antibody (NBP2-48513)

Find related products by research area.

Blogs on ISYNA1

There are no specific blogs for ISYNA1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ISYNA1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ISYNA1