ISYNA1 Antibody - BSA Free

Western Blot: ISYNA1 Antibody [NBP1-54984] - Analysis of HepG2 cell lysate. Antibody Dilution: 1.0 ug/ml ISYNA1 is supported by BioGPS gene expression data to be expressed in HepG2.

Western Blot: ISYNA1 Antibody [NBP1-54984] - Titration: 0.2-1 ug/ml Positive Control: Human Lung.

Western Blot: ISYNA1 Antibody [NBP1-54984] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ISYNA1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to ISYNA1(myo-inositol 1-phosphate synthase A1) The peptide sequence was selected from the N terminal of ISYNA1. Peptide sequence LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ISYNA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 61 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ISYNA1 Antibody - BSA Free

• EC 5.5.1.4
• hINO1
• hIPS
• INO1
• INOS
• inositol-3-phosphate synthase 1
• IPSIPS 1
• MI-1-P synthase
• MIP synthase
• Myo-inositol 1-phosphate synthase A1
• Myo-inositol-1-phosphate synthase

Background

Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate (Seelan et al., 2004 [PubMed 15464731]).[supplied by OMIM].

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ISYNA1
• Uniprot:
  • Q9NPH2(Human)