Isocitrate Dehydrogenase 1/IDH1 Recombinant Protein Antigen

Images

 
There are currently no images for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Isocitrate Dehydrogenase 1/IDH1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IDH1.

Source: E. coli

Amino Acid Sequence: FVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IDH1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87428.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Isocitrate Dehydrogenase 1/IDH1 Recombinant Protein Antigen

  • Cytosolic NADP-isocitrate dehydrogenase
  • EC 1.1.1.42
  • IDCD
  • IDH
  • IDH1
  • IDP
  • IDPC
  • isocitrate dehydrogenase [NADP] cytoplasmic
  • isocitrate dehydrogenase 1 (NADP+), soluble
  • Isocitrate Dehydrogenase 1
  • NADP(+)-specific ICDH
  • NADP-dependent isocitrate dehydrogenase, cytosolic
  • NADP-dependent isocitrate dehydrogenase, peroxisomal
  • Oxalosuccinate decarboxylase
  • PICD

Background

Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22166
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NB110-61646
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-67429
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-32104
Species: Hu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NBP1-86036
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-89559
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-05078
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87069
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB120-13888
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, CyTOF-ready, Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KD, KO, WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP2-45978
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
AF7094
Species: Hu
Applications: IHC
NBP1-87428PEP
Species: Hu
Applications: AC

Publications for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP) (0)

There are no publications for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP) (0)

There are no reviews for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Isocitrate Dehydrogenase 1/IDH1 Products

Research Areas for Isocitrate Dehydrogenase 1/IDH1 Protein (NBP1-87428PEP)

Find related products by research area.

Blogs on Isocitrate Dehydrogenase 1/IDH1

There are no specific blogs for Isocitrate Dehydrogenase 1/IDH1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Isocitrate Dehydrogenase 1/IDH1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol IDH1