IRF7 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: IRF7 Antibody [NBP2-38678] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: IRF7 Antibody [NBP2-38678] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: IRF7 Antibody [NBP2-38678] - Staining of human small intestine shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: IRF7 Antibody [NBP2-38678] - Staining of human kidney shows strong nuclear positivity in cells in tubules.

Immunohistochemistry-Paraffin: IRF7 Antibody [NBP2-38678] - Staining of human placenta shows moderate nuclear positivity in trophoblastic cells.

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

IRF7 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: HPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLELRGPQLWARRMGKCKVYW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: IRF7
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  IRF7 Protein (NBP2-38678PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for IRF7 Antibody - BSA Free

• interferon regulatory factor 7
• interferon regulatory factor-7H
• IRF-7
• IRF7A
• IRF-7H

Background

IRF7 encodes interferon regulatory factor 7, a member of the interferon regulatory transcription factor (IRF) family. IRF7 has been shown to play a role in the transcriptional activation of virus-inducible cellular genes, including interferon beta chain genes. Inducible expression of IRF7 is largely restricted to lymphoid tissue. Multiple IRF7 transcript variants have been identified, although the functional consequences of these have not yet been established.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: IRF7
• Uniprot:
  • Q92985(Human)