IRF5 Antibody

Images

 
Western Blot: IRF5 Antibody [NBP2-14128] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: IRF5 Antibody [NBP2-14128] - Staining in human lymph node and skeletal muscle tissues. Corresponding IRF5 RNA-seq data are presented for the same tissues.
Western Blot: IRF5 Antibody [NBP2-14128] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunohistochemistry-Paraffin: IRF5 Antibody [NBP2-14128] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells and non-germinal center cells.
Immunohistochemistry-Paraffin: IRF5 Antibody [NBP2-14128] - Staining of human bone marrow shows moderate cytoplasmic positivity in hematopoietic cells.
Immunohistochemistry-Paraffin: IRF5 Antibody [NBP2-14128] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: IRF5 Antibody [NBP2-14128] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: IRF5 Antibody [NBP2-14128] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

IRF5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEE E
Specificity
Specificity of human IRF5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
IRF5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
IRF5 Protein (NBP2-14128PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for IRF5 Antibody

  • IBD14
  • interferon regulatory factor 5
  • IRF5
  • IRF-5
  • SLEB10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67868
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5366
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Single Cell Western
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
NBP1-87825
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-26506
Species: Hu, Mu, Rt
AF8005
Species: Hu
Applications: WB
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western

Publications for IRF5 Antibody (NBP2-14128) (0)

There are no publications for IRF5 Antibody (NBP2-14128).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRF5 Antibody (NBP2-14128) (0)

There are no reviews for IRF5 Antibody (NBP2-14128). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRF5 Antibody (NBP2-14128) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IRF5 Products

Bioinformatics Tool for IRF5 Antibody (NBP2-14128)

Discover related pathways, diseases and genes to IRF5 Antibody (NBP2-14128). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRF5 Antibody (NBP2-14128)

Discover more about diseases related to IRF5 Antibody (NBP2-14128).
 

Pathways for IRF5 Antibody (NBP2-14128)

View related products by pathway.

PTMs for IRF5 Antibody (NBP2-14128)

Learn more about PTMs related to IRF5 Antibody (NBP2-14128).
 

Research Areas for IRF5 Antibody (NBP2-14128)

Find related products by research area.

Blogs on IRF5

There are no specific blogs for IRF5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IRF5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol IRF5
Entrez