BANK1 Antibody - BSA Free

Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining in human lymph node and cerebral cortex tissues using anti-BANK1 antibody. Corresponding BANK1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human tonsil shows moderate to strong cytoplasmic positivity in germinal center cells.

Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human fallopian tube shows weak to moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BANK1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BANK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  BANK1 Protein (NBP1-88714PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BANK1 Antibody - BSA Free

• BANK1
• BANKFLJ20706B-cell scaffold protein with ankyrin repeats
• B-cell scaffold protein with ankyrin repeats 1
• FLJ34204

Background

The protein encoded by the BANK1 gene is a B-cell-specific scaffold protein that functions in B-cell receptor-induced calcium mobilization from intracellular stores. This protein can also promote Lyn-mediated tyrosine phosphorylation of inositol 1,4,5-trisphosphate receptors. Polymorphisms in this gene are associated with susceptibility to systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BANK1 Antibody (NBP1-88714)(1)

Publication using NBP1-88714

• Bernal-Quiros M, Wu YY, Alarcon-Riquelme ME et al. BANK1 and BLK Act through Phospholipase C Gamma 2 in B-Cell Signaling. PLoS One 2013-01-01 [PMID: 23555801]

Bioinformatics

• Gene Symbol: BANK1