BANK1 Antibody

Images

 
Immunohistochemistry-Paraffin: BANK1 Antibody [NBP1-88714] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BANK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RHGHKELKKIFEDFSIQEIDINNEQENDYEEDIASFSTYIPSTQNPAFHHESRKTYGQSADGAEANEMEGEGKQNGSGMETKHSPL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BANK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
BANK1 Protein (NBP1-88714PEP)
Publications
Read Publication using NBP1-88714.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23555801)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BANK1 Antibody

  • BANK1
  • BANKFLJ20706B-cell scaffold protein with ankyrin repeats
  • B-cell scaffold protein with ankyrin repeats 1
  • FLJ34204

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1092
Species: Hu
Applications: WB, ChIP, Flow, PEP-ELISA
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
MAB3428
Species: Hu
Applications: WB, IHC
MAB10541
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-77533
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-P, IP, CyTOF-ready
NBP1-18933
Species: Hu, Mu
Applications: WB, IP
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NB100-2265
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-83663
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-03109
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF4084
Species: Hu
Applications: WB, IHC, ICFlow
NBP1-91235
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IF
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready

Publications for BANK1 Antibody (NBP1-88714)(1)


Reviews for BANK1 Antibody (NBP1-88714) (0)

There are no reviews for BANK1 Antibody (NBP1-88714). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for BANK1 Antibody (NBP1-88714) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BANK1 Products

BANK1 NBP1-88714

Bioinformatics Tool for BANK1 Antibody (NBP1-88714)

Discover related pathways, diseases and genes to BANK1 Antibody (NBP1-88714). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BANK1 Antibody (NBP1-88714)

Discover more about diseases related to BANK1 Antibody (NBP1-88714).
 

Pathways for BANK1 Antibody (NBP1-88714)

View related products by pathway.

PTMs for BANK1 Antibody (NBP1-88714)

Learn more about PTMs related to BANK1 Antibody (NBP1-88714).

Blogs on BANK1

There are no specific blogs for BANK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BANK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BANK1
Entrez