Recombinant Human IRAK4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human IRAK4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-130 of Human IRAK4

Source: Wheat Germ

Amino Acid Sequence: MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDK

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
IRAK4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
39.93 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human IRAK4 Protein

  • EC 2.7.11
  • EC 2.7.11.1
  • interleukin-1 receptor-associated kinase 4
  • IPD1
  • IRAK4
  • IRAK-4
  • NY-REN-64
  • REN64
  • Renal carcinoma antigen NY-REN-64

Background

IRAK4 - interleukin-1 receptor-associated kinase 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77068
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IP
NB100-56566
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-26506
Species: Hu, Mu, Rt
NB100-56722
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IP, B/N, Flow-CS
7270-IL/CF
Species: Hu
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-24906
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC, IF
NBP2-24729
Species: Hu, Mu, Rt, Ca, Eq, Mk, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
AF8691
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56447
Species: Hu, Mu
Applications: WB
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP1-76782
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF

Publications for IRAK4 Partial Recombinant Protein (H00051135-Q01) (0)

There are no publications for IRAK4 Partial Recombinant Protein (H00051135-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IRAK4 Partial Recombinant Protein (H00051135-Q01) (0)

There are no reviews for IRAK4 Partial Recombinant Protein (H00051135-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for IRAK4 Partial Recombinant Protein (H00051135-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for IRAK4 Partial Recombinant Protein (H00051135-Q01)

Discover related pathways, diseases and genes to IRAK4 Partial Recombinant Protein (H00051135-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IRAK4 Partial Recombinant Protein (H00051135-Q01)

Discover more about diseases related to IRAK4 Partial Recombinant Protein (H00051135-Q01).
 

Pathways for IRAK4 Partial Recombinant Protein (H00051135-Q01)

View related products by pathway.

PTMs for IRAK4 Partial Recombinant Protein (H00051135-Q01)

Learn more about PTMs related to IRAK4 Partial Recombinant Protein (H00051135-Q01).
 

Research Areas for IRAK4 Partial Recombinant Protein (H00051135-Q01)

Find related products by research area.

Blogs on IRAK4.

IRAK4: The "master IRAK" critical for initiating immune responses
IRAK4, also known as Interleukin-1 receptor-associated kinase 4, is a serine/threonine-protein kinase that plays a critical role in initiating innate and adaptive immune responses against foreign pathogens. It activates NF-kappaB in both Toll-like rec...  Read full blog post.

Customers Who Bought This Also Bought

IRAK4 Antibody
NB500-597-0.1mg
IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human IRAK4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol IRAK4