Home » NRK » NRK Antibodies » NRK Antibody

NRK Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: NRK Antibody [NBP1-84121] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells and decidua cells.
Immunohistochemistry-Paraffin: NRK Antibody [NBP1-84121] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells and decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

NRK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRRSQSSPPYSTIDQKLLVDIHVPDGFKVGKISPPVYLTNEWVGYNALSEIFRNDWLTPAPVIQPPEEDGDYVELYDASADTDGDDDDESNDTFEDTYDHANGNDDLDNQVDQANDVCKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NRK Protein (NBP1-84121PEP)
Publications
Read Publication using NBP1-84121.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRK Antibody

  • DKFZp686A17109
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ16788
  • MGC131849
  • NESK
  • Nik related kinase
  • nik-related protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(27 Reviews)
(588 Publications)
Species: Hu
Applications: BA
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Feline corneal stromal cells. IHC-Fr and IF (Alexa Fluor488) were performed using NBP1-91258 at 1:400. Image captured by epifluorescent microscopy. Image from verified customer review.
Western Blot: Fibronectin Antibody [NBP1-91258] - Analysis of Fibronectin in HepG2 cell lysate.
Immunohistochemistry-Frozen: Fibronectin Antibody [NBP1-91258] - Trabecular meshwork (TM) region of pig eyes. NBP1-91258 Fibronectin antibody was labelled with Alexa Fluor 488 conjugated secondary antibody (Green). DAPI shown as blue. Image from verified customer review.
(11 Reviews)
(38 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(6 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
TNF-alpha
[Unconjugated]
210-TA
1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
Recombinant Human TNF-alpha (Catalog # 210‑TA) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is 25‑100 pg/mL.
(36 Reviews)
(708 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (SY0297)
NBP2-67471
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in A549 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Staining Phospho-c-Jun(S63) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: c-jun [p Ser63] Antibody (SY0297) [NBP2-67471] - Analysis of paraffin-embedded human breast carcinoma tissue using anti-Phospho-c-Jun(S63) antibody. Counter stained with hematoxylin.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Recombinant Human
PTHLH/PTHrP Protein
NBP2-35224
SDS-Page: Human PTHLH/PTHrP Protein [NBP2-35224]
Species: Hu
Applications: Func, PAGE
TGF-alpha
239-A
TGF-alpha
(1 Review)
(47 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Left: NBP2-50037 staining (green) in HeLa cells, which were treated with serum-starvation for 36 hrs, followed by 2 hrs 20% FBS stimulation (bottom), or PBS treatment (top). Green c-Fos staining only localizes in the nuclei of stimulated cells, but not in un-stimulated cells. Cells are counter-stained with chicken pAb against Vimentin (NB300-223, red). Blue shows DAPI staining of nucleus. Middle: Mouse brain section (45 uM; fixed by transcardial perfusion with 4% PFA) labeled with NBP2-50037 using a standard HRP-DAB staining technique. Cells expressing c-Fos show dark color in nucleus. Right: Mouse cortical section labeled with NBP2-50037 (red) and rabbit polyclonal anti-NeuN (NBP1-92716, green) using IF confocal. Neurons positive for c-Fos and RBFOX3/NeuN appear to be yellow. Inset shows an enlarged image of NBP2-50037 staining. Nuclei are labeled with Dapi (blue).
(1 Review)
(9 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western blot shows lysates of CHP-100 human neuroblastoma cell line, C6 rat glioma cell line, and C2C12 mouse myoblast cell line. PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa and 54 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
Western blot shows recombinant human JNK1, JNK2, and JNK3 (1 ng/lane). PVDF membrane was probed with 1 µg/mL Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band for JNK1 was detected at approximately 46 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 4.
JNK1 was detected in immersion fixed MCF‑7 human breast cancer cell line using Mouse Anti-Human/Mouse/Rat JNK1 Monoclonal Antibody (Catalog # MAB17761) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cell surfaces. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Reviews)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
CCL2/JE/MCP-1 [HRP]
DCP00
(8 Reviews)
(215 Publications)
Species: Hu
Applications: ELISA
HRAS Antibody
NBP2-42864
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with HRAS antibody diluted at 1:500. HRP-conjugated anti-rabbit IgG antibody was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Various whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-RAS antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: HRAS Antibody [NBP2-42864] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 12% SDS-PAGE, and the membrane was blotted with H-Ras antibody diluted at 1:5000.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CTGF/CCN2 Antibody
(88430) - C-terminus
MAB660
CTGF/CCN2 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using 25 µg/mL Human CTGF/CCN2 C-Terminus Monoclonal Antibody (Catalog # MAB660) overnight at 4 °C. Tissue was stained with the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(4 Reviews)
(6 Publications)
Species: Hu
Applications: IHC
DBT Antibody
NBP1-89522
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human pancreas shows weak to moderate cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human testis shows weak to moderate cytoplasmic positivity in Leydig cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NRK Antibody (NBP1-84121)(1)


Reviews for NRK Antibody (NBP1-84121) (0)

There are no reviews for NRK Antibody (NBP1-84121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NRK Antibody (NBP1-84121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRK Products

Array NBP1-84121

Bioinformatics Tool for NRK Antibody (NBP1-84121)

Discover related pathways, diseases and genes to NRK Antibody (NBP1-84121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRK Antibody (NBP1-84121)

Discover more about diseases related to NRK Antibody (NBP1-84121).
 

Pathways for NRK Antibody (NBP1-84121)

View related products by pathway.

PTMs for NRK Antibody (NBP1-84121)

Learn more about PTMs related to NRK Antibody (NBP1-84121).
 

Research Areas for NRK Antibody (NBP1-84121)

Find related products by research area.

Blogs on NRK

There are no specific blogs for NRK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRK Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol NRK