NRK Antibody

Images

 
Immunohistochemistry-Paraffin: NRK Antibody [NBP1-84121] - Staining of human placenta shows cytoplasmic positivity in trophoblastic cells and decidua cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

NRK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRRSQSSPPYSTIDQKLLVDIHVPDGFKVGKISPPVYLTNEWVGYNALSEIFRNDWLTPAPVIQPPEEDGDYVELYDASADTDGDDDDESNDTFEDTYDHANGNDDLDNQVDQANDVCKD
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NRK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
NRK Protein (NBP1-84121PEP)
Publications
Read Publication using NBP1-84121.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for NRK Antibody

  • DKFZp686A17109
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ16788
  • MGC131849
  • NESK
  • Nik related kinase
  • nik-related protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

236-EG
Species: Hu
Applications: BA
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-35224
Species: Hu
Applications: Func, PAGE
239-A
Species: Hu
Applications: BA
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
DCP00
Species: Hu
Applications: ELISA
NBP2-42864
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NRK Antibody (NBP1-84121)(1)

Reviews for NRK Antibody (NBP1-84121) (0)

There are no reviews for NRK Antibody (NBP1-84121). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for NRK Antibody (NBP1-84121) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional NRK Products

Array NBP1-84121

Bioinformatics Tool for NRK Antibody (NBP1-84121)

Discover related pathways, diseases and genes to NRK Antibody (NBP1-84121). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for NRK Antibody (NBP1-84121)

Discover more about diseases related to NRK Antibody (NBP1-84121).
 

Pathways for NRK Antibody (NBP1-84121)

View related products by pathway.

PTMs for NRK Antibody (NBP1-84121)

Learn more about PTMs related to NRK Antibody (NBP1-84121).
 

Research Areas for NRK Antibody (NBP1-84121)

Find related products by research area.

Blogs on NRK

There are no specific blogs for NRK, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our NRK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NRK