IPP Antibody (4C2)

Images

 
Sandwich ELISA: IPP Antibody (4C2) [H00003652-M01] - Detection limit for recombinant GST tagged IPP is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4C2
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

IPP Antibody (4C2) Summary

Immunogen
IPP (NP_005888.1, 105 a.a. - 204 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHSGEEFLALTKDQLIKILRSEELSIEDEYQVFLAA
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
IPP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for IPP Antibody (4C2)

  • actin-binding protein IPP
  • intracisternal A particle-promoted polypeptideKLHL27Kelch-like protein 27

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00003611-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB6257
Species: Hu, Mu, Rt
Applications: WB
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
H00003652-M01
Species: Hu
Applications: ELISA

Publications for IPP Antibody (H00003652-M01) (0)

There are no publications for IPP Antibody (H00003652-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IPP Antibody (H00003652-M01) (0)

There are no reviews for IPP Antibody (H00003652-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for IPP Antibody (H00003652-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional IPP Products

IPP H00003652-M01

Bioinformatics Tool for IPP Antibody (H00003652-M01)

Discover related pathways, diseases and genes to IPP Antibody (H00003652-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for IPP Antibody (H00003652-M01)

Discover more about diseases related to IPP Antibody (H00003652-M01).
 

Pathways for IPP Antibody (H00003652-M01)

View related products by pathway.

PTMs for IPP Antibody (H00003652-M01)

Learn more about PTMs related to IPP Antibody (H00003652-M01).

Blogs on IPP

There are no specific blogs for IPP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our IPP Antibody (4C2) and receive a gift card or discount.

Bioinformatics

Gene Symbol IPP
Uniprot