Intra Acrosomal Protein Antibody - BSA Free

Western Blot: Intra Acrosomal Protein Antibody [NBP2-34054] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Testis

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human lymph node.

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining in human testis and endometrium tissues using anti-ACRV1 antibody. Corresponding ACRV1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-ACRV1 antibody NBP2-34054 (A) shows similar protein distribution across tissues to independent antibody NBP1-88038 (B).

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human cerebral cortex.

Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP2-34054] - Staining of human liver.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Intra Acrosomal Protein Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TSSQPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACRV1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Intra Acrosomal Protein Protein (NBP2-34054PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Intra Acrosomal Protein Antibody - BSA Free

• acrosomal protein SP-10
• acrosomal vesicle protein 1D11S4365
• SP-10
• SPACA2
• sperm protein 10

Background

Intra Acrosomal Protein is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The gene encoding this protein consists of 4 exons and its alternative splicing generates 11 distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining 7 transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACRV1
• Uniprot:
  • P26436(Human)