SPACA3 Antibody

Images

 
Western Blot: SPACA3 Antibody [NBP1-89136] - Analysis in control (vector only transfected HEK293T lysate) and SPACA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human testis shows strong cytoplasmic positivity in spermatids.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining in human testis and endometrium tissues using anti-SPACA3 antibody. Corresponding SPACA3 RNA-seq data are presented ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Analysis in human testis and endometrium tissues. Corresponding SPACA3 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human endometrium shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human fallopian tube shows no positivity in glandular cells as expected.
Immunohistochemistry: SPACA3 Antibody [NBP1-89136] - Staining of human prostate shows no positivity in glandular cell as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPACA3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPACA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPACA3 Protein (NBP1-89136PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPACA3 Antibody

  • CT54ALLP17Cancer/testis antigen 54
  • LYC3Sperm protein reactive with ASA
  • Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17
  • Lysozyme-like protein 3
  • lysozyme-like sperm-specific secretory protein ALLP17
  • LYZL31700025M08Rik
  • SLLP1MGC119058
  • sperm acrosome associated 3
  • sperm acrosome membrane-associated protein 3
  • sperm lysozyme like protein 1
  • Sperm lysozyme-like protein 1
  • Sperm protein reactive with antisperm antibodies
  • SPRASA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81279
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-61118
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-82810
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80792
Species: Hu
Applications: WB, IHC, IHC-P
NB300-229
Species: Mu, Rt, Ch, Ma, Pm, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-58172
Species: Hu, Mu
Applications: WB
NBP1-88038
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85416
Species: Hu
Applications: IHC, IHC-P
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41184
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-1411
Species: Hu
Applications: WB, PEP-ELISA
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP1-92065
Species: Hu
Applications: IHC, IHC-P
NBP2-14921
Species: Hu
Applications: WB, IHC, IHC-P
AF8549
Species: Hu
Applications: WB, Simple Western

Publications for SPACA3 Antibody (NBP1-89136) (0)

There are no publications for SPACA3 Antibody (NBP1-89136).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPACA3 Antibody (NBP1-89136) (0)

There are no reviews for SPACA3 Antibody (NBP1-89136). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPACA3 Antibody (NBP1-89136) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SPACA3 Products

Bioinformatics Tool for SPACA3 Antibody (NBP1-89136)

Discover related pathways, diseases and genes to SPACA3 Antibody (NBP1-89136). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPACA3 Antibody (NBP1-89136)

Discover more about diseases related to SPACA3 Antibody (NBP1-89136).
 

Pathways for SPACA3 Antibody (NBP1-89136)

View related products by pathway.

Blogs on SPACA3

There are no specific blogs for SPACA3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPACA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPACA3