SPACA3 Antibody

Western Blot: SPACA3 Antibody [NBP1-89136] - Analysis in control (vector only transfected HEK293T lysate) and SPACA3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human testis shows strong cytoplasmic positivity in spermatids.

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human endometrium shows low expression as expected.

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining in human testis and endometrium tissues using anti-SPACA3 antibody. Corresponding SPACA3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Analysis in human testis and endometrium tissues. Corresponding SPACA3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human endometrium shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: SPACA3 Antibody [NBP1-89136] - Staining of human fallopian tube shows no positivity in glandular cells as expected.

Immunohistochemistry: SPACA3 Antibody [NBP1-89136] - Staining of human prostate shows no positivity in glandular cell as expected.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SPACA3 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TNNGIFQINSRRWCSNLTPNVPNVCRMYCSDLLNPNLKDTVICAMKITQEPQGLGYWEAWRHHCQGKDLTEWVDGCDF
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SPACA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:2500 - 1:5000
  • Immunohistochemistry-Paraffin 1:2500 - 1:5000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SPACA3 Protein (NBP1-89136PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SPACA3 Antibody

• CT54ALLP17Cancer/testis antigen 54
• LYC3Sperm protein reactive with ASA
• Lysozyme-like acrosomal sperm-specific secretory protein ALLP-17
• Lysozyme-like protein 3
• lysozyme-like sperm-specific secretory protein ALLP17
• LYZL31700025M08Rik
• SLLP1MGC119058
• sperm acrosome associated 3
• sperm acrosome membrane-associated protein 3
• sperm lysozyme like protein 1
• Sperm lysozyme-like protein 1
• Sperm protein reactive with antisperm antibodies
• SPRASA

Background

Sperm surface membrane protein that may be involved in sperm-egg plasma membrane adhesion and fusion duringfertilization. It could be a potential receptor for the egg oligosaccharide residue N-acetylglucosamine, which ispresent in the extracellular matrix over the egg plasma membrane. The processed form has no detectable bacteriolyticactivity in vitro

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SPACA3