SPESP1 Antibody

Images

 
Western Blot: SPESP1 Antibody [NBP2-13370] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SPESP1 Antibody [NBP2-13370] - Staining of human testis shows strong cytoplasmic positivity in spermatids/ acrosomal cap.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPESP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: YPSITVTPDEEQNLNHYIQVLENLVRSVPSGEPGREKKSNSPKHVYSIAS KGSKFKELVTHGDASTENDVLTNPISEETTTFPTG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPESP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SPESP1 Protein (NBP2-13370PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPESP1 Antibody

  • ESP
  • Glycosylated 38 kDa sperm protein C-7/8
  • MGC24663
  • sperm equatorial segment protein 1
  • SP-ESPEquatorial segment protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-30455
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-04611
Species: Hu
NB300-164
Species: Hu, Po, Ca, Rt(-)
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88221
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83790
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
AF4779
Species: Hu
Applications: WB, IHC
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
NBP2-13370
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SPESP1 Antibody (NBP2-13370) (0)

There are no publications for SPESP1 Antibody (NBP2-13370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPESP1 Antibody (NBP2-13370) (0)

There are no reviews for SPESP1 Antibody (NBP2-13370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPESP1 Antibody (NBP2-13370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPESP1 Products

Bioinformatics Tool for SPESP1 Antibody (NBP2-13370)

Discover related pathways, diseases and genes to SPESP1 Antibody (NBP2-13370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPESP1 Antibody (NBP2-13370)

Discover more about diseases related to SPESP1 Antibody (NBP2-13370).
 

Pathways for SPESP1 Antibody (NBP2-13370)

View related products by pathway.

Blogs on SPESP1

There are no specific blogs for SPESP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPESP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPESP1