Intra Acrosomal Protein Antibody

Images

 
Western Blot: Intra Acrosomal Protein Antibody [NBP1-88038] - Analysis in control (vector only transfected HEK293T lysate) and ACRV1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in ...read more
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human lymph node.
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human testis shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining in human testis and endometrium tissues using anti-ACRV1 antibody. Corresponding ACRV1 RNA-seq data ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human cerebral cortex, liver, lymph node and testis using Anti-ACRV1 antibody NBP1-88038 (A) ...read more
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human cerebral cortex.
Immunohistochemistry-Paraffin: Intra Acrosomal Protein Antibody [NBP1-88038] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Intra Acrosomal Protein Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACRV1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Intra Acrosomal Protein Protein (NBP1-88038PEP)
Publications
Read Publication using NBP1-88038.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24598113)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Intra Acrosomal Protein Antibody

  • acrosomal protein SP-10
  • acrosomal vesicle protein 1D11S4365
  • SP-10
  • SPACA2
  • sperm protein 10

Background

Intra Acrosomal Protein is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The gene encoding this protein consists of 4 exons and its alternative splicing generates 11 distinct transcripts, which encode protein isoforms ranging from 81 to 265 amino acids. The longest transcript is the most abundant, comprising 53-72% of the total acrosomal vesicle protein 1 messages; the second largest transcript comprises 15-32%; the third and the fourth largest transcripts account for 3.4-8.3% and 8.7-12.5%, respectively; and the remaining 7 transcripts combined account for < 1% of the total acrosomal vesicle protein 1 message. It is suggested that phenomena of cryptic splicing and exon skipping occur within this gene. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP2-14260
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-93736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
366-6C/CF
Species: Hu
Applications: BA
NBP2-13370
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-69021
Species: Hu
Applications: IHC, IHC-P
DY346
Species: Hu
Applications: ELISA
H00058524-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF933
Species: Ha, Hu, Mu, Rt
Applications: Block, Flow, IHC, IP, Simple Western, WB
NBP2-19561
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-89136
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-76420
Species: Hu, Mu
Applications: Flow, ICC, IHC, IHC-P, IP, Simple Western, WB
NBP1-88038
Species: Hu
Applications: WB, IHC

Publications for Intra Acrosomal Protein Antibody (NBP1-88038)(1)

Reviews for Intra Acrosomal Protein Antibody (NBP1-88038) (0)

There are no reviews for Intra Acrosomal Protein Antibody (NBP1-88038). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Intra Acrosomal Protein Antibody (NBP1-88038) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Intra Acrosomal Protein Products

Diseases for Intra Acrosomal Protein Antibody (NBP1-88038)

Discover more about diseases related to Intra Acrosomal Protein Antibody (NBP1-88038).
 

Pathways for Intra Acrosomal Protein Antibody (NBP1-88038)

View related products by pathway.

PTMs for Intra Acrosomal Protein Antibody (NBP1-88038)

Learn more about PTMs related to Intra Acrosomal Protein Antibody (NBP1-88038).

Blogs on Intra Acrosomal Protein

There are no specific blogs for Intra Acrosomal Protein, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Intra Acrosomal Protein Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACRV1