Intersectin 1 Antibody

Images

 
Western Blot: Intersectin 1 Antibody [NBP1-87806] - Analysis in human cell line NTERA-2.
Immunohistochemistry-Paraffin: Intersectin 1 Antibody [NBP1-87806] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Intersectin 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ITSN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500 - 1:1000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Intersectin 1 Protein (NBP1-87806PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Intersectin 1 Antibody

  • 11
  • intersectin 1 (SH3 domain protein)
  • intersectin short variant 12
  • intersectin-1
  • ITSN
  • SH3 domain protein-1A
  • SH3 domain-containing protein 1A
  • Src homology 3 domain-containing protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-46852
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NBP1-71833
Species: Hu, Mu
Applications: WB
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
MAB8480
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40773
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
AF6260
Species: Hu
Applications: WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-32505
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Intersectin 1 Antibody (NBP1-87806) (0)

There are no publications for Intersectin 1 Antibody (NBP1-87806).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Intersectin 1 Antibody (NBP1-87806) (0)

There are no reviews for Intersectin 1 Antibody (NBP1-87806). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Intersectin 1 Antibody (NBP1-87806) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Intersectin 1 Products

Bioinformatics Tool for Intersectin 1 Antibody (NBP1-87806)

Discover related pathways, diseases and genes to Intersectin 1 Antibody (NBP1-87806). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Intersectin 1 Antibody (NBP1-87806)

Discover more about diseases related to Intersectin 1 Antibody (NBP1-87806).
 

Pathways for Intersectin 1 Antibody (NBP1-87806)

View related products by pathway.

PTMs for Intersectin 1 Antibody (NBP1-87806)

Learn more about PTMs related to Intersectin 1 Antibody (NBP1-87806).

Blogs on Intersectin 1

There are no specific blogs for Intersectin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Intersectin 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ITSN1