Intersectin 1 Antibody - BSA Free

Western Blot: Intersectin 1 Antibody [NBP1-87806] - Analysis in human cell line NTERA-2.

Immunohistochemistry-Paraffin: Intersectin 1 Antibody [NBP1-87806] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu, Mu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Intersectin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ITVLEQQDMWWFGEVQGQKGWFPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGDLTFQQGDVILVTKKDGDWW
• Predicted Species: Mouse (91%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITSN1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Intersectin 1 Protein (NBP1-87806PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Intersectin 1 Antibody - BSA Free

• 11
• intersectin 1 (SH3 domain protein)
• intersectin short variant 12
• intersectin-1
• ITSN
• SH3 domain protein-1A
• SH3 domain-containing protein 1A
• Src homology 3 domain-containing protein

Background

Intersectin 1 is an adapter protein that may provide an indirect link between the endocytic membrane traffic and the actin assembly machinery. It may regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling. Intersectin 1 is overexpressed in brain from Down syndrome foetuses suggesting a gene dosage-dependent contribution to the abnormalities of Down syndrome. Intersectin 1 interacts with dynamin, CDC42, SNAP25 and SNAP23. It clusters several dynamin in a manner that is regulated by alternative splicing. Intersectin 1 also binds clathrin-associated proteins and other components of the endocytic machinery, such as SPIN90, EPS15, EPN1, EPN2 and STN2. Adapter protein that may provide indirect link between the endocytic membrane traffic and the actin assembly machinery. May regulate the formation of clathrin-coated vesicles. Isoform 1 could be involved in brain-specific synaptic vesicle recycling.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITSN1