Integrin beta 8 Antibody - BSA Free

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Analysis in human cervix, uterine and liver tissues using NBP1-87539 antibody. Corresponding Integrin beta 8 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human cervix, uterine shows strong membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human kidney shows strong membranous positivity in cells in tubules.

Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human endometrium shows strong membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Integrin beta 8 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ITGB8
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Integrin beta 8 Protein (NBP1-87539PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Integrin beta 8 Antibody - BSA Free

• Integrin beta 8
• integrin beta-8
• integrin, beta 8
• ITGB8

Background

The Integrin beta 8 gene is a member of the integrin beta chain family and encodes a single-pass type I membrane protein with a VWFA domain and four cysteine-rich repeats. This protein noncovalently binds to an alpha subunit to form a heterodimeric integrin complex. In

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ITGB8