Integrin beta 8 Antibody


Immunohistochemistry-Paraffin: Integrin beta 8 Antibody [NBP1-87539] - Staining of human retina shows moderate positivity in outer limiting membrane.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Integrin beta 8 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: AQHCVNSKGQVCSGRGTCVCGRCECTDPRSIGRFCEHCPTCYTACKENWNCMQCLHPHNLSQAILDQCKTSCALMEQQHY
Specificity of human Integrin beta 8 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Integrin beta 8 Protein (NBP1-87539PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (85%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Integrin beta 8 Antibody

  • Integrin beta 8
  • integrin beta-8
  • integrin, beta 8
  • ITGB8


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, IP
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
Species: Hu, Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP

Publications for Integrin beta 8 Antibody (NBP1-87539) (0)

There are no publications for Integrin beta 8 Antibody (NBP1-87539).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 8 Antibody (NBP1-87539) (0)

There are no reviews for Integrin beta 8 Antibody (NBP1-87539). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Integrin beta 8 Antibody (NBP1-87539) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Integrin beta 8 Products

Bioinformatics Tool for Integrin beta 8 Antibody (NBP1-87539)

Discover related pathways, diseases and genes to Integrin beta 8 Antibody (NBP1-87539). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Integrin beta 8 Antibody (NBP1-87539)

Discover more about diseases related to Integrin beta 8 Antibody (NBP1-87539).

Pathways for Integrin beta 8 Antibody (NBP1-87539)

View related products by pathway.

PTMs for Integrin beta 8 Antibody (NBP1-87539)

Learn more about PTMs related to Integrin beta 8 Antibody (NBP1-87539).

Research Areas for Integrin beta 8 Antibody (NBP1-87539)

Find related products by research area.

Blogs on Integrin beta 8

There are no specific blogs for Integrin beta 8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Integrin beta 8 Antibody and receive a gift card or discount.


Gene Symbol ITGB8