Integrin beta 3/CD61 Recombinant Protein Antigen

Images

 
There are currently no images for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Integrin beta 3/CD61 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Integrin beta 3/CD61

Source: E.coli

Amino Acid Sequence: VRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDTVSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGTFECGVCRCGP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

Protein/Peptide Type
Recombinant Protein Antigen
Gene
ITGB3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-76484It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Integrin beta 3/CD61 Recombinant Protein Antigen

  • CD61 antigen
  • CD61
  • GP3A
  • GP3Aplatelet glycoprotein IIIa
  • GPIIIA
  • GPIIIaintegrin beta-3
  • INGRB3
  • Integrin beta 3
  • integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)
  • ITG B3
  • ITGB3
  • Platelet membrane glycoprotein IIIa

Background

Platelet membrane glycoprotein Integrin beta-3 (GP IIIa) forms a Ca2+-dependent heterodimer complex with GP IIb. The GP IIb-IIIa complex constitutes the fibrinogen and fibronectin receptor on stimulated platelets. A biochemically and immunologically similar membrane glycoprotein complex is present on endothelial cells. Homology suggests that GP IIIa is a member of a family of cell-surface adhesion receptors. (1) Data provide further support for the key role of the cytoplasmic domain of the beta3 integrin in cell adhesion and suggest a potential role for the beta3C integrin subunit in modulating cell-matrix interactions (2). It has been demonstrated that the beta 3 subunit of alpha IIb beta 3 was phosphorylated on tyrosine residues in response to thrombin-induced platelet aggregation. Data suggest that tyrosine phosphorylation of an integrin beta subunit may be important in initiating outside-in signaling cascades by inducing association of signaling components directly with the integrin (3). be important in initiating outside-in signaling cascades by inducing association of signaling components directly with the integrin (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7616
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-81858
Species: Hu
Applications: IHC,  IHC-P, WB
7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
137-PS
Species: Hu
Applications: BA
NBP1-97507
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-88866
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr,  IHC-P, WB
NBP1-89296
Species: Hu
Applications: IHC,  IHC-P, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr,  IHC-P
NB600-233
Species: Hu, Mu
Applications: ChIP, CHIP-SEQ, IHC,  IHC-P, IP, WB

Publications for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP) (0)

There are no publications for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP) (0)

There are no reviews for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Integrin beta 3/CD61 Products

Research Areas for Integrin beta 3/CD61 Recombinant Protein Antigen (NBP2-76484PEP)

Find related products by research area.

Blogs on Integrin beta 3/CD61

There are no specific blogs for Integrin beta 3/CD61, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Integrin beta 3/CD61 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ITGB3