Integrin alpha V/CD51 Antibody (10T9N2)

Western Blot: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] - Analysis of extracts of various cell lines, using Integrin alpha V/CD51 (ITGAV/CD51) antibody (NBP3-15647) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

ICC/IF: Integrin alpha V/CD51 Antibody (7O8N2) [NBP3-15647] -ITGAV Antibody [NBP3-15647] was used (1:100) for labeling and microscopy analysis of the distribution of ITGAV proteins in SUM159 cells. Validated customer review.

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Mouse liver tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: Integrin alpha V/CD51 Antibody (10T9N2) [Integrin alpha V/CD51] - Immunohistochemistry analysis of paraffin-embedded Human spleen tissue using Integrin alpha V/CD51 Rabbit mAb at a dilution of 1:2000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 10T9N2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Integrin alpha V/CD51 Antibody (10T9N2) Summary

• Description: Novus Biologicals Rabbit Integrin alpha V/CD51 Antibody (10T9N2) (NBP3-15647) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 949-1048 of human Integrin alpha V/CD51 (NP_002201.2). SLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPHENGEGNSET
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: ITGAV
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunocytochemistry/ Immunofluorescence Validated from a verified customer review
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:1000 - 1:6000
• Theoretical MW: 116 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for Integrin alpha V/CD51 Antibody (10T9N2)

• antigen identified by monoclonal L230
• CD51 antigen
• CD51
• Integrin alpha V
• integrin alpha-V
• integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
• ITGAV
• MSK8
• Vitronectin Receptor alpha
• Vitronectin receptor subunit alpha
• VNRA
• VNRADKFZp686A08142

Background

Integrin alpha V chain interacts with the integrin beta 3 subunit/CD61 to form the alpha-V-beta-3 heterodimer/vitronectin receptor. It is expressed on endothelial cells, some activated leukocytes, NK cells, macrophages, neutrophils, and platelets. Integrin alpha V also forms heterodimers with the integrin beta 1, beta 5, beta 6, and beta 8 subunits. Alpha-V-beta-3 is an activation dependent receptor for platelet attachment and spreading on vitronectin and other matrix components.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Reviews for Integrin alpha V/CD51 Antibody (NBP3-15647) (2)

Average Rating: 4.5

(Based on 2 reviews)

We have 2 reviews tested in 1 species: Human.

reviewed by: Nick Dordai ICC Human 12/01/2022

Summary

• Application: Immunocytochemistry
• Sample Tested: SUM159
• Species: Human
• Lot: 400000463

reviewed by: Verified Customer WB Human 10/20/2022

Summary

• Application: Western Blot
• Sample Tested: MDA-MB-231 Cell Lysate,SUM-159PT human breast cancer cell line
• Species: Human
• Lot: 400000463

Bioinformatics

• Gene Symbol: ITGAV